KEGG   Enterobacter cloacae GGT036: EC036_43240Help
Entry
EC036_43240       CDS       T03429                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00471  D-Glutamine and D-glutamate metabolism
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EC036_43240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eclg01011]
    EC036_43240
Enzymes [BR:eclg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     EC036_43240
Peptidoglycan biosynthesis and degradation proteins [BR:eclg01011]
 Precursor biosynthesis
  Racemase
   EC036_43240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF1847
Motif
Other DBs
NCBI-ProteinID: AIV31971
Position
complement(4687601..4688413)
Genome map
AA seq 270 aa AA seqDB search
MLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPYGEKSEDFIVERVVEIVTAVQQRY
PLALAVIACNTASTVSLPALRAKFQFPVVGVVPAIKPAARLTANGIVGLLATRGTVKRPY
TRELIDRFANECQIAMLGSAELVEMAEAKLHGKTVPLEELRRILRPWLRMPEPPDTVVLG
CTHFPLLQEELLEVLPEGTRLVDSGAAIARRTAWLLEHEAPDAKSADANIAFCMALTDET
EQLLPVLRRYGFETLEKLALQHGFEQKRDG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatttgattccggcgtcggtgggctttcggtctatgatgagattcggcatctc
ctgccggatctccattatatctacgccttcgataacgtcgctttcccttatggggagaag
agtgaggactttattgttgagcgtgtcgttgaaatcgtcaccgcggtacagcagcgttat
cccctggcgctggcggtcatcgcctgtaatacggcaagtacggtatcgctgccagccttg
cgcgcaaaatttcagttcccggttgtgggcgtcgttcccgcaataaagcctgctgcgcgc
ctgactgcgaatggtattgtgggtctgctggctacgcgcggcacggtgaagcgtccttat
acgcgtgagttgatcgatcgttttgccaatgaatgtcagatcgcgatgctcggttcggca
gagctggtggagatggctgaagcgaagctgcatggcaagacggtgccacttgaggagctg
cgtcgtattcttcgcccgtggctgcgtatgccggaaccgccggataccgtcgtattgggc
tgcactcatttcccgctcttacaggaagaattgttagaagtactgccggaggggacgcgt
ctggtggattccggtgcggctattgcccgtcgtactgcctggctgctggaacatgaagcg
ccggatgccaaatctgccgatgcgaatatcgcgttttgtatggcactaacagacgagact
gaacaacttttacccgttttgcgccgttatgggtttgaaacgctcgaaaaactcgcgctg
cagcacggttttgagcaaaaaagagacggttga

DBGET integrated database retrieval system