KEGG   Enterobacter cloacae ECNIH5: ECNIH5_02535Help
Entry
ECNIH5_02535      CDS       T03706                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli00010  Glycolysis / Gluconeogenesis
ecli00030  Pentose phosphate pathway
ecli00051  Fructose and mannose metabolism
ecli00680  Methane metabolism
ecli01100  Metabolic pathways
ecli01110  Biosynthesis of secondary metabolites
ecli01120  Microbial metabolism in diverse environments
ecli01130  Biosynthesis of antibiotics
ecli01200  Carbon metabolism
Module
ecli_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNIH5_02535
   00030 Pentose phosphate pathway
    ECNIH5_02535
   00051 Fructose and mannose metabolism
    ECNIH5_02535
  09102 Energy metabolism
   00680 Methane metabolism
    ECNIH5_02535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecli04147]
    ECNIH5_02535
Enzymes [BR:ecli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ECNIH5_02535
Exosome [BR:ecli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNIH5_02535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AIX57697
UniProt: A0A145TU74
Position
complement(525250..526248)
Genome map
AA seq 332 aa AA seqDB search
MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGE
VQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEHAKYVVLMDPLDGSSNIDV
NVSVGTIFSIYRRVTPVGTPVTEEDFLQPGSKQVAAGYVVYGSSTMLVYTTGCGVHAFTY
DPSLGVFCLSQERMRFPEKGNTYSINEGNYIRFPNGVKKYIKFCQEEDKATQRPYTSRYI
GSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYECNPMAFLAEQAGGKASDGKERILDI
VPESLHQRRSFFVGNDHMVEDVERMIREFPDA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttaggtgaatttattgtcgaaaagcagcacgagttctctcatgctacgggt
gagctcactgctttgctgtcggcaataaagctgggcgctaagatcatccaccgcgatatc
aacaaggccggtctggtcgatatcctgggtgccagcggtgccgagaacgttcagggtgag
gttcagcagaaactcgacctgttcgccaatgaaaaactgaaagcagcactgcgcgcgcgc
gacatcgttgcgggtatcgcctctgaagaagaagatgagatcgtcgtattcgaagggtgt
gaacacgcaaaatacgttgttctgatggatccgctggacggctcctccaacatcgacgtt
aacgtttctgtcggtaccattttctccatctaccgtcgcgtcaccccggttggcacaccg
gtgacggaagaagacttcctgcagccgggcagcaagcaggttgctgccggttacgtggtg
tatggctcatccaccatgctggtgtacaccaccggctgcggcgtgcacgcctttacctac
gatccgtcgctgggcgttttctgtctgagccaggagcgcatgcgcttcccggagaagggc
aatacctactccatcaacgaaggcaactacatccgattcccgaatggcgtgaagaagtac
atcaaattctgccaggaagaggataaagccacccagcgcccgtacacctcgcgctatatc
ggctcgctggtggcggatttccaccgtaacctgctgaagggcggtatttacctctaccca
agcaccgccagccacccggacggaaaactgcgtctgctgtacgagtgcaacccgatggca
ttcctggccgaacaggcaggcggcaaagcgagtgacggtaaagagcgtattctggatatc
gtgccggaaagcctgcaccagcgccgttcgttctttgtcggcaacgaccacatggtggaa
gacgttgaacgcatgatccgcgaattcccggacgcgtaa

DBGET integrated database retrieval system