KEGG   Enterobacter cloacae ECNIH5: ECNIH5_17385Help
Entry
ECNIH5_17385      CDS       T03706                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli00071  Fatty acid degradation
ecli00280  Valine, leucine and isoleucine degradation
ecli00310  Lysine degradation
ecli00362  Benzoate degradation
ecli00380  Tryptophan metabolism
ecli00620  Pyruvate metabolism
ecli00630  Glyoxylate and dicarboxylate metabolism
ecli00640  Propanoate metabolism
ecli00650  Butanoate metabolism
ecli00900  Terpenoid backbone biosynthesis
ecli01100  Metabolic pathways
ecli01110  Biosynthesis of secondary metabolites
ecli01120  Microbial metabolism in diverse environments
ecli01130  Biosynthesis of antibiotics
ecli01200  Carbon metabolism
ecli01212  Fatty acid metabolism
ecli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH5_17385
   00630 Glyoxylate and dicarboxylate metabolism
    ECNIH5_17385
   00640 Propanoate metabolism
    ECNIH5_17385
   00650 Butanoate metabolism
    ECNIH5_17385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECNIH5_17385
   00072 Synthesis and degradation of ketone bodies
    ECNIH5_17385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNIH5_17385
   00310 Lysine degradation
    ECNIH5_17385
   00380 Tryptophan metabolism
    ECNIH5_17385
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECNIH5_17385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNIH5_17385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECNIH5_17385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecli04147]
    ECNIH5_17385
Enzymes [BR:ecli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECNIH5_17385
Exosome [BR:ecli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNIH5_17385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIX60428
UniProt: A0A155PRJ2
Position
complement(3698928..3700106)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGVAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatctcggcagcgtggtggtaagagcgctggtggaacgc
agcggggttgccgcacatgaaattgatgaggtgatcctcggccaggtgctgaccgcgggc
gcgggacaaaaccctgcgcgccaggcggcgctgaagggcggcctgcctaataccgtttcg
gcgattaccatcaacgacgtctgtggttcaggtttgaaagcgctccaccttgcgacgcag
gccatccagtgcggtgaagcggacgtggtcattgccggagggcaggaaaacatgagccgc
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcgggaacagtcaactgctt
gacagcctggttcatgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggcatcagccgcgagcttcaggatgcgtatgcgctt
agctcgcagcaaaaagcgcgtgcagcgatcgactccggccgttttcgcgatgaaattgtc
ccggtcagtacccaacgccagaacggcgaagcgctcatcgttgataccgacgagcagcct
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggccttcgaaacgctcggt
tctgtaacggcaggtaacgcatcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcgcatcaaagcgtttgcc
agcgtgggtgttgatcctgcgttaatggggatcgccccggtctatgccacgcgccgctgt
cttgagcgggcgggttggcaactgaacgatgtagatctgattgaagtcaatgaagccttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggtgcgatcgcgctcggtcatcccattggcgcttccggctgccgcattctggtg
tcgctagtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgcata
ggcggagggcagggggtagccctggctatcgaacggtaa

DBGET integrated database retrieval system