KEGG   Enterobacter cloacae ECNIH5: ECNIH5_19985Help
Entry
ECNIH5_19985      CDS       T03706                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ecli00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ECNIH5_19985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ecli03011]
    ECNIH5_19985
Ribosome [BR:ecli03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECNIH5_19985
  Bacteria
    ECNIH5_19985
  Archaea
    ECNIH5_19985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIX60909
UniProt: A0A0F1PNH1
Position
complement(4217869..4218201)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgcacagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggacatcctgacctataccaac
aagaaagctgcggtattggtcaagaaagtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacatcgacgatctgaaagtcgcgaaaattttcgtagatgaaggccca
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system