KEGG   Enterobacter cloacae ECNIH5: ECNIH5_20345Help
Entry
ECNIH5_20345      CDS       T03706                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli00010  Glycolysis / Gluconeogenesis
ecli00020  Citrate cycle (TCA cycle)
ecli00620  Pyruvate metabolism
ecli01100  Metabolic pathways
ecli01110  Biosynthesis of secondary metabolites
ecli01120  Microbial metabolism in diverse environments
ecli01130  Biosynthesis of antibiotics
ecli01200  Carbon metabolism
Module
ecli_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNIH5_20345
   00020 Citrate cycle (TCA cycle)
    ECNIH5_20345
   00620 Pyruvate metabolism
    ECNIH5_20345
Enzymes [BR:ecli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ECNIH5_20345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIX60978
Position
4279896..4281512
Genome map
AA seq 538 aa AA seqDB search
MRVNGLTPQDLKAYGIHDVQEVVYNPDYDTLYQEELNPALEGYERGVLTNLGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWADKGKGKNDNKPLSPETWQHLKGLVTHQLSGKRLFIV
DAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPTDEELQNFTPDFIVMNGAKCTNPQWK
EQGLNSENFIAFNLTERIQLIGGTWYGGEMKKGMFSVMNYLLPLRGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIY
HAIRRDALLENVTVRADGSVDFDDASKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTASQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILDGSLDNAETFTLPMFNLA
IPTELPGVDTRILDPRNTYGSPEQWREKAESLAKLFIENFEKYTDTPAGAALVNAGPR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttaatggtttaaccccgcaagatctcaaggcttatggtattcacgacgtccag
gaagtggtctacaaccccgattacgatacgctgtatcaggaagagctcaatccggcactg
gaagggtacgagcgaggtgtgttgacgaatcttggtgctatcgccgtcgataccggtatt
tttaccggccgttcgccgaaagataaatacatcgtccgagatgataccacccgcgatacg
ctgtggtgggccgataaaggcaaagggaagaacgataacaaaccgctctctcctgaaacc
tggcagcatctgaaagggctcgtcacccatcagctttccggcaagcgtctgttcatcgtc
gatgctttctgcggcgctaacgccgacacccgtctctccgttcggtttatcactgaagtg
gcctggcaggcgcatttcgtgaagaacatgttcattcgtccgaccgatgaagaactgcaa
aacttcacccctgactttatcgtgatgaacggcgcgaaatgcaccaacccgcagtggaaa
gaacagggtctgaactccgaaaacttcatcgccttcaacctgaccgagcgtatccagctg
atcggcggtacctggtacggcggcgaaatgaagaaagggatgttctcggtcatgaactac
ctgctgccgctgcgcggtatcgcctccatgcactgctcggcgaacgtcggtgaaaaaggt
gacgtggcggtgttcttcggcctttccggcaccggtaaaacgactctgtccaccgatcca
aaacgtcgtctgattggcgacgacgagcacggctgggacgacgacggtgtgtttaacttt
gaaggcggctgctacgcgaaaaccattcgcctgtctgaagaggcagagccggatatctac
cacgcgattcgccgcgatgcgctgctggaaaacgtcaccgtgcgtgccgatggctctgtc
gacttcgacgatgcgtccaaaaccgaaaacacccgcgtctcttatccgatttaccacatc
gacaacatcgtgaagccggtgtcgaaggcgggccacgccacgaaggtgattttcctgacc
gcagacgcgttcggcgtgttgccaccggtttcccgcctgaccgccagccagacgcagtac
cacttcctctctggctttaccgctaagctggcgggtaccgagcgcggtgtgaccgagcca
accccaaccttctccgcatgcttcggcgcggcgttcctgtcgctacacccaacgcagtat
gcggaagtgctggtgaaacgcatgcaggcatccggcgcacaggcatacctggtgaacacc
ggctggaacgggacgggcaaacgtatctccatcaaagatacacgcgccatcatcgacgcg
attctggatggttcattggataacgccgagacctttacgctgccgatgttcaatctggcg
atcccaacagagctgcctggcgtggatacgcgtatcctcgatccgcgtaacacctatggt
tcaccggaacagtggcgcgagaaggcagaatcgctggcgaaactgtttatcgaaaacttc
gagaagtataccgacaccccggcgggtgctgcgctggtgaatgcgggaccaaggtaa

DBGET integrated database retrieval system