KEGG   Enterobacter cloacae ECNIH4: ECNIH4_01690Help
Entry
ECNIH4_01690      CDS       T03486                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00520  Amino sugar and nucleotide sugar metabolism
ecln01100  Metabolic pathways
ecln01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ecln_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECNIH4_01690
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ECNIH4_01690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecln01005]
    ECNIH4_01690
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     ECNIH4_01690
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     ECNIH4_01690
Lipopolysaccharide biosynthesis proteins [BR:ecln01005]
 Unusual sugar
  ECNIH4_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIX53024
Position
359562..361544
Genome map
AA seq 660 aa AA seqDB search
MKAVVFAYHDMGCAGTLALLEAGYDIAAIFTHPDTAGENHFFSSVARIAAERGIPVYAPD
DVNHPLWVERIRALAPDVIFSFYYRNLICDEILGLAAKGAFNLHGSLLPAYRGRAPLNWV
LVNGETETGVTLHRMVHRADAGAIVAQHRVAIDADETALQLHQKLCTVAQSLLRDALPAI
LNGTFSETAQDESKASTFGRRTPEDGRLDWNQPARQLHNLVRAVTDPWPGAYSFAGVSKF
IVWKSRVRDDIPAAKPGTVVSVSPLIVSCGEEALEIITGQTDSGLYVQGMQLAQSLGLVA
GALITSAPVVAVKRRTRVLILGVNGFIGNHLTERLLKDDNYEIYGLDIGADAISRFLDNP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYDKRIIFPSTSEVYGMCTDKNFDEDTSNLVVGPINKQRWIYSVSKQLLDRVIWAYGEK
EGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIEGGKQKRCFTDI
SDGIEALFRIIENKDNRCNGQIINIGNPDNEASIRELAEMLLASFERHPLRDKFPPFAGF
REVESSSYYGKGYQDVEHRKPSIRNAKRCLNWTPTVKMEQTIDETLDFFLRTVELSEQVS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgtatttgcctatcacgatatggggtgcgcgggcacgctggccctgctg
gaagcgggctatgacattgcggcaatctttacccatccggacacggcgggcgaaaatcac
tttttcagctcagtggcgcgcatcgccgccgagcgggggattccggtttatgccccggac
gacgtgaaccacccgctgtgggtggagcgcatccgcgcgcttgcccctgatgtcatcttc
tcgttttactatcgcaacctgatctgcgacgagatcctcggcctggccgcaaaaggagca
tttaaccttcacggctcactgctgccagcctaccgtgggcgcgcgccgctgaactgggtg
ctggtgaacggcgaaacggaaacgggcgtgaccctgcaccggatggtccaccgtgcggat
gcgggggccatcgttgcccagcaccgcgtggcaatcgatgcggatgaaacggcgctgcag
ctgcaccagaaactttgcaccgtggcacaaagcctgctgcgcgacgcgctgccagctatc
ctgaacggcaccttcagcgagaccgcgcaggatgagagcaaagccagtaccttcggtcgc
cgcacgccggaggatggccgcctggactggaaccaacctgctcgccagcttcataacctg
gtgcgcgccgtgaccgacccgtggccgggggcatacagctttgcgggcgtgagcaaattt
atcgtctggaaatcccgcgtgcgcgacgacatcccggcggcaaaaccgggcaccgttgtc
tccgtctccccgctgattgtgagctgcggcgaggaggcgctggagattattaccgggcaa
accgacagcggtctttacgtgcagggcatgcagctggcccagtctctggggctggtcgcc
ggggcgctgatcacaagcgccccggtggttgccgttaaacgccgcacccgcgtgctgatc
ctcggcgtgaacggctttatcgggaaccacctgactgaacgcctgctcaaagacgataac
tacgaaatctatggcctggatattggcgcggatgcgatcagtcgtttcctcgacaaccca
cgcttccatttcgtggaaggggatatcagcatccattccgagtggattgaataccacatt
aaaaaatgtgacgtggtactgccgctggtcgccatcgccacgcctatcgagtacacccgt
aacccgctgcgcgtgttcgagctggacttcgaggagaacctgaagatcattcgcgactgc
gtgaaatacgacaagcgcatcatcttcccgtccacctctgaagtgtacggcatgtgtacc
gacaaaaacttcgacgaagacacctctaacctggtggtcgggccgatcaacaaacagcgc
tggatctactctgtctccaaacagctgctggatcgcgtgatttgggcctacggtgagaaa
gaggggctgcgctttaccctgttccgtccgttcaactggatgggcccgcgtctggataac
ctgaacgcggcgcgtatcggtagctcccgtgcgatcacccagctgatcctaaacctggta
gaaggctcaccgattaagcttatcgaaggcggcaaacagaaacgctgcttcacggatatc
agcgacggtatcgaagcgctgttccgcatcatcgaaaacaaagataaccgctgcaacggt
caaatcatcaacatcgggaaccctgacaacgaagcgagcattcgcgaactggctgagatg
ctgctggccagctttgagcgccatccgctgcgcgataaattcccaccgtttgccggtttc
cgtgaagtggaaagcagcagctactacggtaaaggctaccaggacgttgagcatcgtaag
ccgagcattcgcaatgcgaagcgctgcctgaactggacaccgacggtgaagatggagcaa
accattgacgagacgctcgatttcttcctgcgcaccgtggagctgtcggaacaggtctca
tga

DBGET integrated database retrieval system