KEGG   Enterobacter cloacae ECNIH4: ECNIH4_07130Help
Entry
ECNIH4_07130      CDS       T03486                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00430  Taurine and hypotaurine metabolism
ecln00620  Pyruvate metabolism
ecln00640  Propanoate metabolism
ecln00680  Methane metabolism
ecln01100  Metabolic pathways
ecln01120  Microbial metabolism in diverse environments
ecln01200  Carbon metabolism
Module
ecln_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH4_07130
   00640 Propanoate metabolism
    ECNIH4_07130
  09102 Energy metabolism
   00680 Methane metabolism
    ECNIH4_07130
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ECNIH4_07130
Enzymes [BR:ecln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     ECNIH4_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AIX54038
UniProt: A0A5E0WHT1
Position
complement(1474247..1475449)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDALNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPNLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFFVTQEAAKILNKPVEEVNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDDINKMLTKESGLLGLTEVTSDCRYVEDNYAEKADAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVIFTGGIGENAAMVRELSLGKLGVLGFDVDHER
NLAARFGKSGFINKEGTRPAIVIPTNEELVIAQDAHRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctcactgaaattcgccatc
atcgatgcgctcaacggtgacgagtacctctctggtttggccgaatgtttccatctgcct
gaagcacgtatcaagtggaagatggacggcagcaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgctcagctgactgcgattggtcaccgtatcgtccacggcggcgaaaaatacacc
agctccgtcgtgatcgacgaatctgttatccagggcatcaaagattctgcctcttttgct
ccgctgcacaacccggcgcacctgatcggtatcgctgaagcgctgaaatccttcccgaat
ctgaaagacaaaaacgtggccgtgttcgacaccgcgttccatcagaccatgccggaagag
tcttacctctatgccctgccatacagcctgtacaaagagcacggcgtacgtcgttacggc
gcgcacggcaccagccacttctttgtgactcaggaagccgcaaaaatcctgaacaaacct
gttgaagaagtgaacatcatcacctgccatctgggcaacggtggttctgtttctgctatc
cgcaacggtaaatgtgttgatacctccatgggtctgaccccgctggaaggtctggtgatg
ggtacccgttccggtgacatcgacccggcgatcatcttccacctgcacgacactctgggc
atgagcgttgacgacatcaacaaaatgctgactaaagagtctggcctgctgggtctgacc
gaagtcaccagcgactgccgctatgttgaagacaactacgcagagaaagcagacgctaaa
cgtgcaatggacgtttactgccaccgtctggcgaaatacatcggttcttacaccgcgctg
atggacggtcgtctggacgcggttatcttcaccggtggtatcggtgagaacgcggctatg
gttcgtgaactgtccctgggcaaactgggcgttctgggcttcgacgttgatcacgagcgt
aacctggctgcgcgtttcggcaagtctggcttcatcaacaaagaaggcacccgtccggct
atcgttatcccaactaacgaagagctggtcatcgcgcaagacgcacaccgcctgactgcc
tga

DBGET integrated database retrieval system