KEGG   Enterobacter cloacae ECNIH4: ECNIH4_07805Help
Entry
ECNIH4_07805      CDS       T03486                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00052  Galactose metabolism
ecln00500  Starch and sucrose metabolism
ecln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECNIH4_07805
   00500 Starch and sucrose metabolism
    ECNIH4_07805
Enzymes [BR:ecln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECNIH4_07805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Glyco_hydro_130
Motif
Other DBs
NCBI-ProteinID: AIX54167
UniProt: A0A2J0PQN8
Position
1631120..1632553
Genome map
AA seq 477 aa AA seqDB search
MTYSITKAEQELQSRREGLNLRWYPRYHLAARAGWMNDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGAEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PDDEANLYQVQCLATSRDGIHFSREGMVVDTPPGLHHFRDPKVWREGESWYMVVGARDGE
TGQVRVYRSEDLHAWQDMGVLAVAEKEMGYMWECPDFFTLNGKRVLMFSPQGVVAEGYKN
RNLFQSGYLLGEWQPGQPFVREGEFVEMDRGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQEDGWAGMLSLPRELTLSADNRLQMRPAREVEGLRGEWFPWPVSTLKNQQITLVEHCD
AMEVMLKWDCANSGAEQYGIRFGDGLRVYVDAQMQRLVLERYYPQYGLCGTRSVALNLND
TLSLRLFVDSSSVEVFVNEGEACLSSRIYPDAECRELALFAWTGAASLIDAGAWQLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattccattacgaaagcagagcaggaacttcagtccagacgcgaggggcttaat
ctgcgctggtatccgcgttaccacctcgctgcacgcgctggctggatgaacgaccctaat
ggcctggtctggtttgatggctggtaccacgccttttatcaacatcatccgtattcgacc
cagtggggcccgatgcactggggccatgcgcgcagcaaggatttagttcactgggaacat
ctcccggttgcactggcgccagaaggagcagaagacaaggatggctgtttttccggatcg
gcagtggtggatggcgatacgcttgcgctgatttacaccggacataaattccacggcgat
cctgatgatgaggcaaatctctaccaggtgcagtgtctggcgaccagccgtgatggtatt
cattttagccgggaaggcatggttgttgacacgccgcctggcctgcatcacttccgtgac
ccgaaagtgtggcgtgagggggagagctggtacatggtcgtcggtgcgcgggacggcgaa
acgggtcaggtgcgcgtatatcgctctgaagatctgcacgcgtggcaggatatgggcgtg
cttgcggtggcagaaaaagagatggggtatatgtgggaatgccctgactttttcactctc
aatggcaagcgcgtactgatgttttcacctcagggagtggtggctgaaggatacaaaaat
cgtaatctatttcagagtggctatctgttgggcgagtggcagcctggtcagccttttgtg
cgagaaggtgagtttgtggagatggatcgcggacatgatttctatgcgccacaaagtttc
ctgacccctgatggccgccgtatcgttatcggctggctggacatgtgggaatccccactg
ccggagcaggaagatggatgggctggcatgctctctttaccgcgtgaactgacgctgagt
gcggataaccgcctgcaaatgcgaccggccagagaggtcgaaggcctccggggagagtgg
ttcccctggccagtaagtactcttaaaaaccagcagattactctggtggaacactgcgac
gcgatggaggtcatgctgaagtgggattgcgccaacagcggtgcagagcaatacggcatt
cgttttggagatggcttacgcgtctatgttgatgcgcagatgcagcgcctggtgctggag
cgttattatccgcagtatggcctgtgcggtacccgaagcgtcgcgctgaacctgaacgac
acgctaagcctgcgcctgttcgttgacagctcgtcagtggaagtgtttgtcaatgaaggg
gaggcgtgcctgagcagccgcatttaccctgatgcagagtgtcgcgaactggcgttgttc
gcgtggaccggggccgcttcgcttatcgatgccggagcatggcaattagggtaa

DBGET integrated database retrieval system