KEGG   Enterobacter cloacae ECNIH4: ECNIH4_14470Help
Entry
ECNIH4_14470      CDS       T03486                                 

Gene name
putA
Definition
(GenBank) transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00250  Alanine, aspartate and glutamate metabolism
ecln00330  Arginine and proline metabolism
ecln01100  Metabolic pathways
ecln01110  Biosynthesis of secondary metabolites
ecln01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECNIH4_14470 (putA)
   00330 Arginine and proline metabolism
    ECNIH4_14470 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecln03000]
    ECNIH4_14470 (putA)
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     ECNIH4_14470 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     ECNIH4_14470 (putA)
Transcription factors [BR:ecln03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    ECNIH4_14470 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AIX55401
Position
3023843..3027805
Genome map
AA seq 1320 aa AA seqDB search
MGMTTMGVKLDDATRERIKTAATRIDRTPHWLIKQAIFNYLERLESDEGLPELPALLAGA
ANESEDAPAAGDESHQPFLEFAEQILPQSVSRAAITGAYRRAETDAVPMLLEQARLPEAI
AAQAHSLAYQLADKLRNQKTATGRAGMVQGLLQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISNGNWHSHIGRSPSLFVNAATWGLLFTGKLVSTHNEANLSRSLNRIIGKSG
EPLIRKGVDMAMRLMGEQFVTGETIAEALANARKLEDKGFRYSYDMLGEAALTAADAQAY
MVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLA
RQYDIGINIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPFVIDYLIDL
ASRSRRRLMIRLVKGAYWDSEIKRAQMEGLEGYPVYTRKVYTDVSYLACAKKLLGVPNLI
YPQFATHNAHTLAAIYSLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADTTLPLDELVADPVQAVEKMAAQEGQIGL
PHPKIALPRELYGAGRVNSAGLDLANEHRLASLSSALLNSALQKWQAKPILEQSVEDGEM
QPVINPAEPKDIVGYVREATEAEVDQALDSAVNNAPIWFATPPQERAAILERAAVLMEDQ
MQSLIGILVREAGKTFSNAIAEVREAVDFLHYYAGQVRDDFDNETHRPLGSVVCISPWNF
PLAIFTGQIAAALAAGNSVLAKPAEQTPLIAAQGINILLEAGVPAGVVQLLPGRGETVGA
KLTSDNRVRGVMFTGSTEVASLLQRNIATRLDAQGRPTPLIAETGGMNAMIVDSSALTEQ
VVVDVLASAFDSAGQRCSALRVLCLQDDVADHTLKMLRGAMAECRMGNPGRLTTDIGPVI
DAEAKANIENHIQTMRAKGRPVFQAVRENSEDAREWQTGTFVPPTLIELASFDELKKEVF
GPVLHVVRYNRNNLNELIDQINASGYGLTLGVHTRIDETIAQVTGSAKVGNLYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPLYLYRLLANRPENALGVTLARQDADYPVDAQLKTVLT
QPLEALIAWAEKRPELRAIAQQYGELAQAGTQRLLPGPTGERNTWTLMPREHVLCVADNE
QDALVQLAAAMATGCEVLWPEDALHRDLAKQLPKAVSARIRFAKADALLTQPFDAVIYHG
DSDQLRELCEQVAARSGAIVSVQGFARGETNLLLERLYVERSLSVNTAAAGGNASLMTIG
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atggggatgaccaccatgggggttaagctggatgacgctacccgcgaacggattaaaacc
gcagcgacccgcattgaccgcacaccgcactggttaatcaagcaggcgatttttaactat
ctggaaagactggagagcgacgaaggcctgccagaactgcctgccctgctggcgggtgcc
gccaatgaaagcgaggatgcgcccgccgctggtgacgaaagccaccagccgttcctcgaa
ttcgccgagcagatcctgccgcagtccgtcagccgtgccgccattaccggcgcttaccgt
cgtgccgaaaccgacgccgtgccgatgctgctggagcaggcccgcctgccggaagccatt
gccgcccaggcgcacagcctggcgtatcagctggccgacaagctgcgcaaccaaaaaacc
gccaccggccgcgccgggatggtgcagggtctgctgcaggagttttccctctcttcacag
gaaggcgtggcgctgatgtgtctggcggaagcgctgctgcgtattccggataaagccacc
cgcgacgcgttgatccgcgacaagatcagcaacggcaactggcattcgcacattggccgc
agcccgtccctgttcgttaacgccgccacctggggcctgctgtttaccggcaaactggtc
tcaacccataacgaagccaacctgtcacgctctttgaaccgcatcatcggtaagagcggc
gagccgctgatccgcaaaggcgtggacatggcgatgcgcctgatgggcgagcagttcgtg
accggcgaaaccattgccgaagcgctggcgaacgcccgcaagctggaagacaaaggtttc
cgctactcgtatgacatgctcggtgaagcggccctgactgccgccgacgcgcaggcctac
atggtctcttatcagcaggcgatccacgccatcggtaaagcctctaacggccgcggtatt
tatgaaggtccgggtatctctatcaaactgtccgccctgcacccgcgctacagccgcgcg
cagtacgaccgcgtgatggaggagctttacccgcgcctgaaatccctgaccctgctggcg
cgccagtatgacatcggcatcaatatcgacgccgaagaggccgaccgtctggagatctcc
ctcgatctgctggaaaaactgtgcttcgagccagagctggcgggctggaacggcattggc
ttcgttatccaggcgtaccagaagcgctgcccgttcgtcattgattatctgattgacctg
gcaagccgcagccgtcgccgcctgatgatccgcctcgtgaaaggcgcctactgggacagc
gaaatcaaacgcgcccagatggaaggtctggaaggctatccggtctatacccgtaaggtc
tacaccgacgtctcttacctcgcctgtgcgaaaaaactgctcggcgtgccgaacctgatc
tacccgcagttcgctacccataacgcccacaccctggcggcaatctacagcctggcgggt
caaaactattatcctggccagtacgagttccagtgcctgcacggcatgggtgaaccgctg
tacgagcaggtgaccggtaaggtagcggatggcaagctgaaccgcccatgccgcatttat
gcgccggtaggtacgcacgaaacgctgctggcgtacctggtgcgtcgtctgctggaaaac
ggcgcgaatacctctttcgtaaaccgcatcgccgacaccacgctgccgctcgacgagctg
gtggccgatccggtgcaggccgttgagaagatggcggcccaggaaggtcagattggtctg
ccgcatccgaagattgccctgccgcgcgagctgtatggcgcaggccgcgtcaactctgcg
ggtctggacctggcgaacgaacatcgtctggcgtccctctcctctgccctgctcaacagc
gcgctgcagaaatggcaggcgaaaccgatccttgagcagtccgtcgaggacggtgagatg
cagccggttatcaacccggcagagccaaaagatatcgtcggctatgtacgcgaagccacc
gaagcggaagtggatcaggcgctggacagtgcggtcaacaacgcgccaatctggtttgcc
accccgccgcaggagcgtgccgccattctggagcgtgctgccgtgctgatggaagatcag
atgcagtcgcttatcggtattctggtgcgtgaagcgggtaaaaccttcagcaacgctatc
gctgaagtgcgtgaggccgtggacttcctgcactactacgcgggtcaggtgcgcgatgat
ttcgataacgaaacccaccgtccgctcggatcggtcgtgtgtatcagcccgtggaacttc
ccgctggctatttttaccggccagattgccgcagcccttgccgcaggtaacagcgtgctg
gccaaaccggcagagcagaccccgctgattgccgcgcagggcatcaacattcttctggaa
gccggcgtacctgcgggcgtggtccagctgctgccaggccgcggcgaaacggtcggcgct
aaactgacctccgataaccgcgtacgcggcgtgatgtttaccggctcgaccgaagttgcc
tctctgctgcagcgcaacattgctacccgtctggatgcgcagggtcgtcctaccccgctc
atcgcggaaaccggcggcatgaacgccatgatcgttgactcctctgccctcaccgaacag
gtggtggtcgacgtgctggcctcggcgttcgacagcgccggtcaacgctgctccgccctg
cgcgtactgtgcctgcaggatgacgtggccgaccacacgctgaaaatgctgcgcggcgcg
atggccgaatgccgtatgggcaacccggggcgtctcaccaccgacatcggcccggtgatt
gacgcggaagccaaagccaatatcgaaaaccacatccagaccatgcgcgccaaaggccgt
ccggtgttccaggcggtgcgtgagaacagcgaagatgcccgcgagtggcagaccggcacc
ttcgtgccgccaacgctgattgagctggcaagcttcgacgagctgaaaaaagaggtcttc
ggtccggtgctgcacgtggtgcgttacaaccgtaacaaccttaatgaactgatcgatcag
atcaacgcctccggctatggcctgacgcttggcgtacacacccgtatcgacgaaaccatc
gcgcaggtgaccggcagtgccaaagtgggcaacctgtacgttaaccgcaacatggtcggc
gcggtcgtgggcgtacagccgttcggcggtgaaggtttgtccggcaccggtccgaaagcg
ggcggtccgctttacctgtaccgtctgctggcgaaccgtccggagaacgcgctgggcgtg
acgctggcacgtcaggacgcagactatccggtcgacgcgcagctgaaaaccgtgctgacg
cagccgcttgaagcgctgatcgcctgggcggaaaaacgtcctgaactgcgtgccattgcg
cagcagtacggcgagctggcgcaggctggcacgcagcgtctgcttccggggccaaccggc
gagcgcaacacctggacgctgatgccgcgcgagcacgtactctgcgtagcggataacgag
caggatgcgctggtacagctggctgccgcgatggcaaccggatgtgaagtgctgtggccg
gaagatgcgctgcatcgcgacctggcaaaacagctgccaaaagccgtttcagcccgcatt
cgcttcgcgaaggccgatgcgctgctgacgcagccgtttgacgccgtgatttatcacggt
gattccgaccagctgcgcgaactgtgcgaacaggtagcggcccgcagcggggcgattgtt
tcggtacagggctttgcgcgtggggaaaccaacctgctgctggagcgtctgtacgtggag
cgttcgctcagcgtcaacaccgcggcggcgggcggtaacgccagcctgatgaccatcggt
taa

DBGET integrated database retrieval system