KEGG   Enterobacter cloacae ECNIH4: ECNIH4_23410Help
Entry
ECNIH4_23410      CDS       T03486                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K18589  dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00670  One carbon pool by folate
ecln00790  Folate biosynthesis
ecln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECNIH4_23410
   00670 One carbon pool by folate
    ECNIH4_23410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ecln01504]
    ECNIH4_23410
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ECNIH4_23410
Antimicrobial resistance genes [BR:ecln01504]
 Gene variants
  Trimethoprim resistance genes
   Dihydrofolate reductases
    ECNIH4_23410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AIX57168
Position
pKPC-860:4264..4737
Genome map
AA seq 157 aa AA seqDB search
MKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYA
VVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLSTIDI
EPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtatcattgatggctgcgaaagcgaaaaacggcgtgattggttgcggtccagac
ataccctggtccgcgaaaggggagcagctactttttaaagcattgacctacaatcagtgg
cttctggtgggtcgcaagacgtttgaatctatgggcgcactccccaataggaaatacgcg
gtcgttacccgctcaggttggacatcaaatgatgacaatgtagttgtatttcagtcaatc
gaagaggccatggacaggctagctgaattcaccggtcacgttatagtgtctggtggcgga
gaaatttaccgagaaacattacccatggcctctacgctccacttatcgacgatcgacatc
gagccagagggggatgttttcttcccgagtattccaaataccttcgaagttgtttttgag
caacactttacttcaaacattaactattgctatcaaatttggaaaaagggttaa

DBGET integrated database retrieval system