KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_06430Help
Entry
ENC_06430         CDS       T02615                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00030  Pentose phosphate pathway
eclo00480  Glutathione metabolism
eclo01100  Metabolic pathways
eclo01110  Biosynthesis of secondary metabolites
eclo01120  Microbial metabolism in diverse environments
eclo01130  Biosynthesis of antibiotics
eclo01200  Carbon metabolism
Module
eclo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eclo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
eclo_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ENC_06430
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ENC_06430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclo04147]
    ENC_06430
Enzymes [BR:eclo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ENC_06430
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ENC_06430
Exosome [BR:eclo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ENC_06430
  Exosomal proteins of colorectal cancer cells
   ENC_06430
  Exosomal proteins of bladder cancer cells
   ENC_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CBK84641
Position
672605..674080
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHPDTRILGVGRADWDKEAYTK
VVREALETFMKEKIDESLWDKLSGRLDFCNLDVNDVGAFTRLGEMLDQENRVTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSREINDQVGEFFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLTADSIRDAKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDDWRWAGVPFYLRTGKRLPAKCSEVVVYFKNPELNLF
KESWQELPQNKLTIRLQPDEGVDIQILNKVPGLDHKHNLQTTKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADQDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcatgtgacctggtcattttcggcgcgaaaggcgat
cttgcacgccgaaaattgctgccttccctgtatcagctcgaaaaagcgggccagatccat
cccgacacccggatccttggggtaggacgcgcagactgggataaggaggcttataccaaa
gtcgtgcgcgaggcgctcgaaacgttcatgaaagagaaaatcgatgaaagcctttgggat
aagctgagcgggcgtctcgatttctgcaacctggacgtcaacgatgtaggcgcctttacc
cgtctgggtgaaatgcttgaccaggaaaatcgtgtcactattaactatttcgccatgccg
ccaagcaccttcggcgccatctgcaaaggtctgggcgaagcgaagctgaacgccaaaccg
gcgcgcgtggtgatggagaaaccgctgggtacgtcgctggcgacctcgcgtgaaatcaac
gaccaggtgggcgagttctttgaggagtgtcaggtttaccgtattgaccactatctgggc
aaagagacggtattgaacctgctggcgctgcgttttgccaactccctgtttgtgaacaac
tgggacaaccgcactatcgaccacgtggaaattaccgtggcggaagaggtgggcatcgaa
ggccgttggggctacttcgaccaggccggccagatgcgggacatgatccagaaccatctg
ctgcaaattctgtgcatgattgccatgtctccaccgtcagatctgacggccgacagcatt
cgtgacgcaaaagtgaaagtgctgaaatcactgcgccgtattgaccgctccaacgtgcgc
gagaaaaccgtgcgcggccagtacaccgcaggttttgcccaggggaaaaaagttcctggc
tatctggaagaagagggcgcgaacaagtccagcaacaccgagacgtttgtggcgatccgc
gtggatatcgacgactggcgctgggccggtgtgccgttctacctgcgtaccggtaaacgt
ctgccggcaaaatgctccgaagtggtggtctacttcaaaaatccggaactgaacctgttc
aaagaatcctggcaggaactgccgcagaacaaactgaccatccgtctgcaaccggacgag
ggtgtggatattcagatcctcaacaaagtgccgggccttgatcacaaacacaacctgcaa
accaccaagctggacctgagctactctgaaaccttcaaccagacgcatctcgccgatgct
tacgagcgtctgctgctggaaaccatgcgtggtatccaggcgctgttcgtccgccgcgat
gaagtggaagaggcgtggaagtgggtcgactccatcactgaagcgtgggcagccgatcag
gatgcgccaaaaccgtatcaggcgggaacctggggacctgtcgcctccgttgcgatgatc
acccgtgatggccgctcctggaacgagtttgaataa

DBGET integrated database retrieval system