KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_10160Help
Entry
ENC_10160         CDS       T02615                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00052  Galactose metabolism
eclo00500  Starch and sucrose metabolism
eclo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ENC_10160
   00500 Starch and sucrose metabolism
    ENC_10160
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ENC_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: CBK84909
Position
1069600..1071006
Genome map
AA seq 468 aa AA seqDB search
MTLSSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWWHDGLWYMVLGAQDRQ
QRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFELDGTHVLICCPQGLAR
EPHRYLNTYPAVWMSGAFDYQTPAFAHGELHELDAGFEFYAPQTTVAEDGRRILIGWLGV
PDGEEMLQPTRAHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHLWQGRASDAPVL
AGARLEFELSASSVNVDFASALRLIVDDEGIRLERASLKTADTLTRYWQGNVHHLRVLCD
CSSAEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatcttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccgcgt
gcgctggcggacagccactatccgcagtggcatcccgcaccggtgacagggctgatgaac
gatccgaacgggtttatctggtttgccgggcgctaccatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgttgggggcactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaatggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgatggcacg
tttgccaaactgggaccggtgttgcccctgccggacgggtacaccgggcacgtccgcgat
ccgaaagtatggtggcatgacgggctgtggtacatggtgctcggcgcgcaggatcgacag
cagcgcggcaaggtgctgctgtttacgtcagccgatttacacacctgggcgtcatgcggc
gaaatcgccggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgagcttgatggcacacacgtcttgatctgctgcccgcaggggctggcgcgc
gaaccgcatcgctatctcaacacctatccggccgtctggatgagtggggcatttgattat
caaacgcctgcatttgcgcacggcgagctgcatgagcttgacgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcatcggctggttgggcgtg
ccggacggcgaagagatgctccagcctacgcgggcgcacggctggatccaccagatgacc
tgtcctcgcgagctgcgctaccgcgacggtaagctctggcaaaccccggtccgtgagctg
gaaacgctgcgcgaggatgaacatctctggcagggacgcgccagcgatgccccggtgctg
gcgggagcgcgtcttgagttcgaactgagcgcatcgagcgtgaacgtggattttgccagc
gcgttgcggctgattgtggatgatgaggggatccgtctggaacgcgccagtctgaaaacc
gcagacacgctgacccgctactggcagggcaatgttcatcatttacgcgtgctgtgcgac
tgttccagcgccgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggtacgcttcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system