KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_26030Help
Entry
ENC_26030         CDS       T02615                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00010  Glycolysis / Gluconeogenesis
eclo00020  Citrate cycle (TCA cycle)
eclo00620  Pyruvate metabolism
eclo01100  Metabolic pathways
eclo01110  Biosynthesis of secondary metabolites
eclo01120  Microbial metabolism in diverse environments
eclo01130  Biosynthesis of antibiotics
eclo01200  Carbon metabolism
Module
eclo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ENC_26030
   00020 Citrate cycle (TCA cycle)
    ENC_26030
   00620 Pyruvate metabolism
    ENC_26030
Enzymes [BR:eclo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ENC_26030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: CBK86105
Position
2623742..2625358
Genome map
AA seq 538 aa AA seqDB search
MRVNGLTPQDLKAYGIHDVQEVVYNPDYDTLYQEELNPALEGYERGVLTNLGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWADKGKGKNDNKPLSPETWQHLKGLVTHQLSGKRLFII
DAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPTDEELQDFTPDFIVMNGAKCTNPQWK
EQGLNSENFIAFNLTERIQLIGGTWYGGEMKKGMFSVMNYLLPLRGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIY
HAIRRDALLENVTVRADGSIDFDDASKTENTRVSYPIYHIENIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTASQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILDGSLDNAETFTLPMFDLA
IPTALPGVDTRILDPRNTYGSPEQWREKAESLAKLFIENFEKYTDTPAGAALVSAGPR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttaatggtttaaccccgcaagatctcaaggcttatggtattcacgacgtccag
gaagtggtctacaaccccgattacgatacgctgtatcaggaagagctcaatccggcactg
gaaggatacgagcgtggtgtgttgacgaacctgggtgctatcgccgtcgatacgggtatt
tttaccggtcgttcgcctaaagataagtatatcgtccgagacgacaccacccgcgatacg
ctgtggtgggctgataagggcaaagggaagaacgataacaaaccgctctccccggaaacc
tggcagcatctgaaaggacttgtcacccatcagctttccggcaagcgtctgtttattatt
gatgcgttctgcggcgctaacgccgacacccgtctctccgtacggttcattactgaagtg
gcctggcaggcgcatttcgtgaagaacatgttcattcgtccgaccgatgaagaactgcaa
gacttcacccctgactttatcgtgatgaacggcgcgaaatgcaccaacccgcagtggaaa
gagcagggtctgaactccgaaaacttcatcgccttcaacctgaccgagcgtatccagctg
atcggcggtacctggtacggcggcgaaatgaagaaagggatgttctcggtcatgaactac
ctgctgccgctgcgcggtatcgcctccatgcactgctcggcgaacgtcggggaaaaaggc
gatgtagcagtgttcttcggcctttccggcaccggtaaaacaacgctgtccaccgatcca
aaacgtcgtctgattggcgacgatgaacacggctgggatgatgacggcgtgtttaacttt
gaaggcggctgctacgcgaagaccattcgcctgtcggaagaggcagagccggatatctac
cacgcgattcgccgcgatgcgctgctggaaaacgtcaccgtgcgtgccgatggttctatc
gacttcgacgatgcctcgaaaacggaaaacacccgcgtctcttacccgatctaccacatc
gagaacatcgtcaagccggtatcgaaggcgggtcatgccacgaaggtgattttcctgacc
gcggatgcgttcggcgtgctgccaccggtttcccgcctgaccgccagccagacgcagtac
catttcctctccggctttaccgctaaactggcgggtaccgagcgcggtgtgaccgagcca
accccaaccttctccgcctgcttcggcgcggcgttcctgtcgctgcacccaacgcagtat
gcggaagtgctggtgaaacgcatgcaggcatccggcgcccaggcgtacctggtgaacacc
ggctggaacggtacgggcaaacgtatctccatcaaagatacacgtgccatcatcgacgcg
attctggatggttcgctggataacgctgagacctttacgctgccgatgttcgatctggcg
atcccaacagcgctgccgggcgtggatacgcgtatcctggatccgcgtaacacctacggt
tcaccggaacagtggcgtgagaaggctgaatcgctggcgaaactgtttatcgaaaacttc
gagaagtataccgacaccccggccggtgctgcgctggtgagtgcgggaccaaggtaa

DBGET integrated database retrieval system