KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_30750Help
Entry
ENC_30750         CDS       T02615                                 

Definition
(GenBank) Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosid ase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00460  Cyanoamino acid metabolism
eclo00500  Starch and sucrose metabolism
eclo01100  Metabolic pathways
eclo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ENC_30750
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ENC_30750
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ENC_30750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CBK86474
Position
complement(3110398..3111825)
Genome map
AA seq 475 aa AA seqDB search
MSIKQITIPPDFMLGAAASAWQTEGWSGKKPGQDSWIDLWYKNDRHVWHNGYGPAVATDF
INRFREDVALMKQAGLTHYRTSINWSRFLTDYENATVDEEYAAYYDALFDEMHRQGIEPM
ICLEHYELPGVLLETYGGWASKHVVELFVRYAEKVFERFHGKVTRWFTFNEPIVVQTRVY
LDALRWPYEQNTSTWMQWNHHKVLATAKVVKLFREKGYDGTVGCILNPEVTYPRSRAPHD
VRAAEMYDLFYNRVFLDPLVHGRYPQALFTLLAQHQVQWEYTADELALIADNTVDELGIN
LYYPHRVKAPSRAWHPETPFHPAYYYEPFELPGRRMNTSRGWEIFPRIIYDMAMRIKNEY
RNIDWFVAESGMGVENEAQFRNRDGIIDDAYRIAFLSEHLYYTLLAREAGANCHGYMLWA
FTDNVSPMNAFKNRYGLIEIDLENHRARRAKKSASWFRQLRDERVLTLRVDDEWK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcataaaacagataaccataccgccagattttatgctgggcgcggcggcatcggcc
tggcagaccgagggctggagcggcaaaaagccggggcaggattcgtggatcgatctctgg
tacaagaacgatcgtcacgtctggcacaacggctacggcccggcggtggcaaccgacttt
atcaatcgctttcgcgaagacgtggcgctgatgaagcaggcgggactgacgcactatcgc
acctcgatcaactggtcgcgctttttgaccgactatgaaaacgccaccgtagatgaagag
tacgccgcctattacgacgcgctgttcgatgaaatgcaccgtcagggcattgagccgatg
atctgcctggaacactacgaattgccgggcgtgctgctggagacctacggcggctgggcg
tcgaagcacgtcgtcgagctgttcgttcgttatgcggaaaaggtgtttgagcgctttcac
ggcaaagtcacccgctggtttacgttcaacgagccgattgtggtccagacgcgcgtctac
cttgacgcactgcgctggccctatgagcagaacaccagcacctggatgcagtggaaccac
cataaggtgctggcgacggcgaaagtggtgaagctgtttcgcgagaaagggtatgacggc
acggtgggttgtattctcaacccggaggtgacctacccgcgctcgcgcgcgccgcatgac
gtgcgggcggcagagatgtacgatctgttctataaccgcgtctttcttgacccgctggtg
cacgggcgctatccgcaggcgctttttaccctgctggcgcagcatcaggtgcagtgggaa
tacacggctgacgagctggcgctgattgccgacaacaccgtcgacgagctgggcattaac
ctctattacccgcatcgcgtcaaagccccgtcccgcgcctggcacccggagacgccgttc
cacccggcgtactactacgagccgttcgagctgccggggcggaggatgaacacctcccgc
ggctgggagatcttcccgcgcattatttacgacatggcgatgcggattaaaaacgagtat
cgcaacattgactggtttgtagcggaaagcgggatgggcgtggagaacgaagcgcagttt
cgcaatcgcgacggcattatcgatgacgcgtaccgcattgcgtttctcagcgaacatctt
tattacacgctgctggcgcgggaggcgggggctaactgccacggctatatgctgtgggcc
ttcaccgacaacgtctccccgatgaacgcgtttaaaaaccgctacgggcttattgagatc
gaccttgaaaaccatcgcgcacggcgggcaaagaaatcggcatcctggtttcgccagctg
cgcgatgagcgtgtgctgacgctcagggttgacgatgaatggaagtaa

DBGET integrated database retrieval system