KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_30930Help
Entry
ENC_30930         CDS       T02615                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00071  Fatty acid degradation
eclo00280  Valine, leucine and isoleucine degradation
eclo00310  Lysine degradation
eclo00362  Benzoate degradation
eclo00380  Tryptophan metabolism
eclo00620  Pyruvate metabolism
eclo00630  Glyoxylate and dicarboxylate metabolism
eclo00640  Propanoate metabolism
eclo00650  Butanoate metabolism
eclo00900  Terpenoid backbone biosynthesis
eclo01100  Metabolic pathways
eclo01110  Biosynthesis of secondary metabolites
eclo01120  Microbial metabolism in diverse environments
eclo01130  Biosynthesis of antibiotics
eclo01200  Carbon metabolism
eclo01212  Fatty acid metabolism
eclo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ENC_30930
   00630 Glyoxylate and dicarboxylate metabolism
    ENC_30930
   00640 Propanoate metabolism
    ENC_30930
   00650 Butanoate metabolism
    ENC_30930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ENC_30930
   00072 Synthesis and degradation of ketone bodies
    ENC_30930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ENC_30930
   00310 Lysine degradation
    ENC_30930
   00380 Tryptophan metabolism
    ENC_30930
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ENC_30930
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ENC_30930
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ENC_30930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclo04147]
    ENC_30930
Enzymes [BR:eclo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ENC_30930
Exosome [BR:eclo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ENC_30930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBK86490
Position
complement(3130400..3131578)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGIAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWELNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatcttggcagcgtggtggtaagagcgctggtggaacgc
agcgggattgccgcacatgaaattgatgaggtgatcctgggccaggtgctgaccgctggc
gcgggacaaaaccctgcgcgccaggcggcgctgaagggcggcctgcctaataccgtttcg
gcaattaccatcaacgacgtctgtggttcaggtttgaaagcgctccatcttgcgacgcag
gccatccagtgcggtgaagcggacgtggtcattgctggcgggcaggagaatatgagccgc
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcgggaatagtcagctgctt
gacagcctggttcacgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggtatcagccgcgagcttcaggatgcatatgccctc
agctcacagcaaaaagcgcgtgcagcgatcgactccgggcgttttcgcgatgaaattgtc
ccggtcagtacccagcgccagaacggcgaagcgctcatcgtcgataccgacgagcagccg
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggcctttgaaacgctcggt
tccgtaacggcaggcaacgcctcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcggattaaagcgtttgcc
agcgtgggcgttgatcccgcgttaatggggatcgccccggtctatgccacgcgccgctgc
ctggagcgggcgggctgggagttgaacgatgtggatctgattgaggtcaacgaagctttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggagccatcgcgctgggccatcccattggcgcctccggctgccgcattctggtg
tcgctggtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgtatt
ggcggggggcagggggtggccctggctatcgaacggtaa

DBGET integrated database retrieval system