KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_45650Help
Entry
ENC_45650         CDS       T02615                                 

Definition
(GenBank) Uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ENC_45650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CBK87654
Position
complement(4652732..4653109)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSVYIESQSTPDEERFVFAYTVTIRNLGRMPVQLLGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPLGTMQGHYEMVDADGNAFRIAIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtctgtgttcaggttcaaagcgtctacattgagtcccaatcc
acaccggatgaagaacgttttgtctttgcttataccgtaaccattcgcaatctggggcgg
atgcctgtgcaactgctcgggcgctactggcttatcaccaacggcaatggccgtgaaatt
gaagtccagggcgaaggcgtggtcggtgaacaaccccatatcgcccctggcgaagagtat
cagtacaccagcggcgcggtaattgaaacgccgctgggtaccatgcaaggccattatgaa
atggtcgatgccgacggcaatgctttccgcattgctattcccgtattccgtctcgccgta
cctacacttattcattaa

DBGET integrated database retrieval system