KEGG   Enterobacter cloacae complex sp. 35734: LI67_004450Help
Entry
LI67_004450       CDS       T04878                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
ecls  Enterobacter cloacae complex sp. 35734
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    LI67_004450 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AKZ72001
UniProt: A0A167QNQ6
Position
1:complement(770283..770660)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVHVQSVYVESQSSPDEERFVFAYTVTIRNLGRTPVQLRGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPMGTMQGHYEMVDVDGNDFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtatgtgtccatgtacaaagcgtttatgttgaatcacagtcc
tcaccggatgaagaacgttttgtctttgcttacaccgtgaccattcgcaatctggggcgg
acgcccgtacagctgcgcggacgctactggcttatcaccaacggcaatggccgcgaaatc
gaagtccagggggaaggtgtggtcggtgaacagcctcatatcgcccctggcgaagagtac
cagtacaccagcggcgcggtgattgaaacgccgatgggtaccatgcaaggccattatgaa
atggtcgacgtcgatggcaatgatttccgcgttgccattcctgtgttccgtctcgccgta
accacactcattcattaa

DBGET integrated database retrieval system