KEGG   Enterobacter cloacae complex sp. 35734: LI67_009105Help
Entry
LI67_009105       CDS       T04878                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00230  Purine metabolism
ecls01100  Metabolic pathways
ecls01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LI67_009105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecls01002]
    LI67_009105
Enzymes [BR:ecls01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     LI67_009105
Peptidases and inhibitors [BR:ecls01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   LI67_009105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AKZ72889
Position
1:complement(1758047..1759630)
Genome map
AA seq 527 aa AA seqDB search
MQSNVSTHGMAVAPHNLASQSALAVLREGGSAIEAMVAAAATIAVVYPHMNGLGGDGFWL
IVPPEGDPIAIDASGAAGSRATLAAYDGLAHIPHRGPRAALTVAGTVSGWDEALKVSREM
TGKALPLARLLADAIDYAQNGTPVTASQAHATASKFDELKAIPGFAETWLVDGKPPQVGS
RFYQPAMATTLTRLAEEGLDSFYRGPLANVLAHGMETLGLPVTLADLNAHAARRTTPLKL
EHQQGEIFNHAPPTQGLVSLAILGITDRLNMAEADDAETLHRIVEATKLAFGLRDAHITD
PRALKTDVQKLLDPAALQALADRVDDSRAAPWGTGKGPGDTVWMGVMDSSGLAVSFIQSL
YHEFGSGVVLPDTGIVWQNRGASFSLDPAHLLALAPGKQPFHTLNPAAARLKDGRVMVYG
SMGGDGQPQTQAALFTRYVVQGIPLQESITRPRWLLGRTWGQTSDTLKLEGRFSPETVAR
LRALGHEVELFPDFSEAMGHAGAIVRHPNGLFEGAFDPRSNGAAAGF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtaatgtctccacgcacggcatggccgttgcgccccacaatcttgccagccag
agcgcgctggcggtgctgcgcgaaggcggcagcgcgatagaggcgatggtcgcggcagcg
gccaccatcgccgtggtttacccgcatatgaacgggctgggcggcgatggcttctggctt
atcgtgccgccggaaggcgaccccatcgccattgacgccagcggcgcggcgggatcgcgc
gcgacgctggccgcctacgacgggctcgcgcatatcccccatcgcgggccccgtgcggcg
ctgaccgtcgccggcacggtaagcggttgggacgaggcgctgaaggtctcgcgtgagatg
acaggcaaggcgctgccgctggcccgcctgctggccgacgccattgactatgcgcagaac
ggcaccccggtcacggcctctcaggcccacgccacggccagcaagttcgacgagctgaag
gccatccccggcttcgcggaaacctggctggtcgacggtaagccaccgcaggtcgggagc
cggttttaccagcccgccatggccacgaccctgacgcgtctggcggaagagggtctcgac
agcttttatcgcggcccgctggcgaacgtactggcgcacggcatggagacgctgggtctc
cccgtgacgctggccgatctcaacgcccacgcggcccggcgcaccacgccgctgaagctg
gagcatcagcagggagagatctttaaccacgccccgccaacgcaggggctggtctcgctg
gcgatactcggcatcaccgaccgcctgaacatggcggaggccgacgacgccgaaaccctt
caccgtatcgtggaagccaccaagctggcctttggcctgcgcgatgcccacatcaccgac
ccgcgcgcgctgaaaaccgatgttcagaaactgctggatcccgccgccctgcaggcgctt
gccgacagggttgacgacagtcgcgcggcgccgtggggcaccggaaaaggccccggcgat
acggtgtggatgggggtgatggacagcagcgggctcgccgtgtcgtttatccagagcctt
tatcacgagttcggcagcggcgtggtgctgcccgacaccggcatcgtctggcagaaccgg
ggggcgtcgttcagcctcgatcccgcccatcttctggccctcgcgccgggcaaacagccg
ttccacaccctgaacccggcggcggcgcgtctgaaggacgggcgcgtgatggtctacggc
tcgatgggcggcgacggacagccgcaaacccaggccgcgctctttacccgctacgttgtc
cagggcatccccctgcaggagagcatcacccgcccacgctggctgctggggcgcacctgg
gggcaaacctcagacaccttaaagcttgaagggcgtttttcacccgagacggtcgcgcgc
ctgcgggcactcggtcacgaggtggagctattccctgactttagtgaagccatgggccac
gcgggcgcgattgttcgccaccccaacgggctgtttgaaggggcatttgacccgcgcagc
aacggcgcggccgccggattctga

DBGET integrated database retrieval system