KEGG   Enterobacter cloacae complex sp. 35734: LI67_009175Help
Entry
LI67_009175       CDS       T04878                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00010  Glycolysis / Gluconeogenesis
ecls01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI67_009175
Enzymes [BR:ecls01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     LI67_009175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AKZ72903
Position
1:1770819..1772060
Genome map
AA seq 413 aa AA seqDB search
MRKALLALAVAGSISATFGVQAQETPEGYQLEQVLIMSRHNLRAPLANNGSVLEQSTPKE
WPEWEVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKTGECPPADSVYAYANSLQRTVAT
AQFFITGAFPGCDVPVHHQEKMGTMDPTFNPVITDNSPEFREKALKAMESERQKMQLGES
YKLLEQMTNYADSPSCKEKKVCSLADAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYY
EGFPADQVAWGEIKTDQQWRVLSKLKNGYQDSLFTSTEVAQNVAKPLVKYIDKTLVTEQA
KAPKITLLVGHDSNIASLLTALDFKPYQLHDQQERTPIGGKIVFQRWHDKNANQELMKIE
YVYQSSEQLRNASVLSLQSPAQRVTLELKGCPVDANGFCPVDKFNAVMNNAAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcactactcgcgctggcagtcgccggttccatttcagcaacgtttggcgta
caggcgcaagagacgccggaagggtatcagctggagcaagttttaatcatgagccgtcac
aacctgcgcgcgccgctggccaataacggcagcgtgctggagcagtccacgccgaaggag
tggccggagtgggaagtgccgggcggccagctcaccaccaaaggtggcgtgctggaggtg
tatatggggcactacatgcgcgagtggctggcgcagcaggggatggtgaagacgggagaa
tgtccaccggcggatagcgtttatgcttacgccaacagcctgcagcgcaccgtcgccacc
gcgcagttcttcattaccggcgcgttcccgggctgcgatgtgcccgtgcaccatcaggaa
aaaatgggcaccatggacccgacattcaatccggtgattaccgataactcgccggaattc
cgcgaaaaagcgctcaaggcgatggagtccgagcggcagaaaatgcagcttggtgaaagc
tacaagctgctggagcagatgaccaactacgccgactcgccgtcctgcaaagagaaaaaa
gtctgctcgctggcggacgcgaaagataccttcagcgccgactatgaaaaagagcctggc
gtatccgggccgctgaaggtgggtaactcgctggtggacgctttcacgctgcagtattac
gaaggcttcccggccgaccaggtggcctggggtgaaatcaaaaccgaccagcagtggcgc
gtgctgtcgaagctgaaaaacggctatcaggactcgctgtttacctctaccgaggtggcg
caaaacgtggcgaaaccgctggtgaagtatatcgataaaacgctggtcaccgagcaggcg
aaagcgcctaagatcaccctgctggtggggcatgattcgaacattgcttccctgctcacc
gccctcgatttcaaaccgtaccagctgcacgaccagcaggagcgcaccccgattggcggc
aagattgtcttccagcgctggcatgacaaaaatgccaaccaggagctgatgaaaattgag
tatgtctatcagagctcagagcagctgcgcaacgccagcgtgctgtcgctgcagtctccg
gcgcagcgcgtgacgctggagctgaagggctgcccggtggatgcgaacggcttctgtcct
gtcgataaattcaatgcggtgatgaataacgcggcgaagtaa

DBGET integrated database retrieval system