KEGG   Enterobacter cloacae complex sp. 35734: LI67_014330Help
Entry
LI67_014330       CDS       T04878                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00052  Galactose metabolism
ecls00500  Starch and sucrose metabolism
ecls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI67_014330
   00500 Starch and sucrose metabolism
    LI67_014330
Enzymes [BR:ecls01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LI67_014330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AKZ73858
Position
1:2835209..2836615
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMTGQPRALADSHYPQWHAAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCEHRFKCWGHWSSADLVHWQHEPLALMPDEDYDRNGCYSGSAVDNQGVLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFTKLGPVLALPEGYTGHVRDPKVWQHEGMWYMVLGAQDVQ
KRGKVLLFKSADLHAWTSCEEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPATWMSGAFDYARATFNHGELHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRAHGWMHQMTCPRELRFRDGRLWQTPARELAALREDEQHWQGRASDAPEL
DATRLEFELSASQVNVDFGGALRLTLDEQGVRLERASLKTGETLARYWQGDVRHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRACMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgcgatcctgcaggccgttatgacaggtcagccgcgg
gcgctggcggacagccattatccgcaatggcacgccgcgccggtgacggggctgatgaac
gacccgaacgggtttatctggtttgctggccgctatcacctgttctatcagtggaacccg
ctggactgcgagcaccgctttaagtgctgggggcactggagttctgcggacctggtgcac
tggcagcatgagccgctggcgctgatgccggatgaagattatgaccgcaacggctgctac
tccggtagcgccgtcgataaccagggcgtactgaccctgtgctacaccggcaacgtcaag
ttcgatgacggcagccgcaccgcctggcagtgcctggccgtggagcagccggacgggacc
tttacgaagctggggccggtgctggcgctgccggaaggctacactggccacgtgcgcgac
ccgaaggtgtggcagcatgaggggatgtggtacatggtgctcggcgcgcaggatgtgcag
aagcgcggcaaggtgctgctctttaaatcagccgatttgcacgcctggacatcctgcgag
gagatcgccggtcacggggttaacggcctgacggacgcgggctatatgtgggagtgtccg
gacctgtttgccctcgacgggacgcacgtcctgatctgctgcccgcaggggcttgcgcgc
gagccgcatcgctacctcaatacctatccggctacctggatgagcggggcgtttgactat
gcccgcgcgacgttcaatcacggcgagctgcacgaactggacgcggggtttgaattctac
gccccgcaaaccacgcttgcggaagatggacgccgcatcctgattggctggatgggcgta
ccggacggggaagagatgcttcagcccacgcgggcgcacggctggatgcaccagatgacc
tgcccgcgagaattgcgcttccgcgacggccggctctggcaaaccccggcgcgcgagctg
gcggcgctgcgtgaagatgagcagcactggcaggggcgcgccagcgacgcgcccgaactg
gacgcgacgcgcctggagtttgagctgagcgcatcgcaggtgaatgtcgattttggcggc
gcgctgcgcctcacgctcgatgagcagggcgtgcgcctggagcgcgcgagcctgaaaacc
ggtgaaacattggcccgctactggcagggcgacgtccgtcatttgcgcgtcctatgcgac
cgctccagcgttgaaattttcattaaccacggcgaaggggtgatgagcagccgctatttt
cctgaccatccggctcgggtgcgattcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcgcctgcatgatagaatga

DBGET integrated database retrieval system