KEGG   Enterobacter cloacae complex sp. 35734: LI67_019200Help
Entry
LI67_019200       CDS       T04878                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecls03009]
    LI67_019200
Enzymes [BR:ecls01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     LI67_019200
Ribosome biogenesis [BR:ecls03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LI67_019200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 Spt5-NGN MIT_C
Motif
Other DBs
NCBI-ProteinID: AKZ74787
UniProt: A0A0F0RXQ8
Position
1:complement(3888203..3889303)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLYCRPGFEKECAAEITDKAAKREIFGFARVKENAGYVVFECYQPEDADKLARELP
FSSLIFARQMFVAGELLKDLPPEDRITPIVGMLQGVVEKGGDLRVEVADTNESKELMKFC
RKFTVPLRAALRDAGVLTNYETPKRPVVHIFFIAPGCCYTGYSYTTNNSPFFMGIPRLRF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVD
NGPMAQSLMDTGQVTWLREDGFRYRPNRNNISWMVCDMVEKPAKVAALMASWLVNGWCRE
TIFNLKLPMKKRYEEVSQNLAYIQEQLDEHGINVEIQARQLYHDREEVTVHIRRWWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgttttatattgtcgcccggggtttgagaaagagtgcgccgcggaaatt
accgataaagcggcgaagcgcgaaatcttcggctttgcccgcgtaaaagaaaacgcgggc
tatgtggtattcgaatgctatcagcctgaagatgcggataagctggcgcgcgaactgccg
ttcagctcgctgatttttgcgcgccagatgtttgtcgcgggtgagctgctcaaagacctt
ccccctgaagaccgcatcacgccaatcgtgggcatgctgcagggcgtggtggagaagggc
ggcgatctgcgcgttgaagtggcggataccaacgaaagtaaagagctgatgaagttctgc
cgtaagttcaccgttccgctgcgcgcggcgctgcgtgatgcgggcgtgctgacgaactac
gaaacgccgaagcgtccggtggtgcatatcttctttattgcaccgggctgctgctatacg
ggctactcgtacaccaccaacaactctcctttctttatgggcatcccgcgtttgcgcttc
ccggccgatgcgccaagccgttccacgctgaagctggaagaggcgttccacgtctttatc
ccggcggatgagtgggatgagcgtctggcaaacggcatgtacgctgtcgatctcggcgcg
tgcccgggcggctggacctatcagctggtgaaacgcaacatgtgggtatcgtccgttgat
aacggcccaatggcgcaaagcctgatggacaccggacaggtcacctggctgcgtgaagac
ggtttccgctatcgcccgaaccgcaacaacatctcatggatggtgtgcgacatggttgag
aaaccggcgaaagtggccgcgctgatggcctcctggctggtgaacggctggtgtcgcgag
accattttcaacctcaagctgccgatgaaaaagcgctatgaggaggtgtcgcagaacctg
gcctacattcaggagcaactggacgaacacgggattaacgtggagatccaggcgcgtcag
ctgtatcacgatcgcgaagaggtgacggtgcatattcgtcgctggtgggcggccgtaggc
gggcgtcgcgacgagcgatag

DBGET integrated database retrieval system