KEGG   Enterobacter cloacae complex sp. 35734: LI67_019400Help
Entry
LI67_019400       CDS       T04878                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00071  Fatty acid degradation
ecls00280  Valine, leucine and isoleucine degradation
ecls00310  Lysine degradation
ecls00362  Benzoate degradation
ecls00380  Tryptophan metabolism
ecls00620  Pyruvate metabolism
ecls00630  Glyoxylate and dicarboxylate metabolism
ecls00640  Propanoate metabolism
ecls00650  Butanoate metabolism
ecls00900  Terpenoid backbone biosynthesis
ecls01100  Metabolic pathways
ecls01110  Biosynthesis of secondary metabolites
ecls01120  Microbial metabolism in diverse environments
ecls01130  Biosynthesis of antibiotics
ecls01200  Carbon metabolism
ecls01212  Fatty acid metabolism
ecls02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI67_019400
   00630 Glyoxylate and dicarboxylate metabolism
    LI67_019400
   00640 Propanoate metabolism
    LI67_019400
   00650 Butanoate metabolism
    LI67_019400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI67_019400
   00072 Synthesis and degradation of ketone bodies
    LI67_019400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI67_019400
   00310 Lysine degradation
    LI67_019400
   00380 Tryptophan metabolism
    LI67_019400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI67_019400
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI67_019400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI67_019400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecls04147]
    LI67_019400
Enzymes [BR:ecls01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI67_019400
Exosome [BR:ecls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI67_019400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKZ74824
Position
1:complement(3934327..3935505)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVKALVERSGIAAQEVDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVIIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISREVQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQGGEVIVVDTDEQPRTDASAEGLARLNPAFEMQG
SVTAGNASSINDGAAAVMMMSESKALELDLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQFSDVDLIEVNEAYAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtaatagtgggtgcgttgcgtacagctatcggctgttttcagggagcg
ctcgcgcgtcattcggcggttgacctgggcagcgtggtggtgaaagcgctggtagaacgt
agcgggatcgcagcacaggaagttgatgaggtgattctgggacaggtcctcacggccggt
gccgggcaaaaccctgcgcgacaggcggcgctgaagggcggactgcccaataccgtctcc
gctatcactatcaacgacgtctgtggttcaggattaaaagcgctgcatctcgcgacgcag
gccattcagtgtggtgaggcggacgtgatcattgcgggcgggcaggagaatatgagccgc
gcgccgcacgtcctgaccgacagccgtaccggcgcgcagctgggtaacagccagctgctc
gacagcctggtgcatgacgggctgtgggatgccttcaacgattatcatatgggcgtaacg
gcggaaaacctggcgcgcgagtacggcatcagccgtgaggtccaggatgcctatgcgtta
agctcgcagcaaaaagcgcgtgcggcgattgattccggccgttttcgcgacgaaattgtc
ccggtcagcacgcagcgtcaggggggcgaggttatcgttgtggataccgatgagcagccg
cgcaccgacgccagcgctgaagggctggcgaggctgaatcctgcgtttgaaatgcagggc
tcggtcacggcgggaaatgcctcttccattaacgacggcgctgctgccgtgatgatgatg
agcgaaagcaaagccctcgaactcgatcttcccgtgctggcccgcattaaggcattcgcc
agcgtgggcgtggatcctgcgttaatggggatcgcgccggtctatgcgacccgtcgctgt
ctggagcgtgcggggtggcagttttctgatgtggatctgatcgaagtgaacgaagcctat
gccgcgcaggcgatctccgtcggaaaaatgctggagtgggatccgctgcgggtcaacgta
aacggtggggcgatcgcgctggggcacccgatcggggcgtccggctgccggatcctggtt
tcgctggtccacgaaatgaaaaagcgcaatgcccgcaaaggaattgccacgctgtgtata
ggcggcgggcaaggggtggcgctggccatcgaacgctaa

DBGET integrated database retrieval system