KEGG   Enterobacter hormaechei subsp. xiangfangensis: LI66_02935Help
Entry
LI66_02935        CDS       T03707                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
eclx  Enterobacter hormaechei subsp. xiangfangensis
Pathway
eclx00010  Glycolysis / Gluconeogenesis
eclx00053  Ascorbate and aldarate metabolism
eclx00071  Fatty acid degradation
eclx00280  Valine, leucine and isoleucine degradation
eclx00310  Lysine degradation
eclx00330  Arginine and proline metabolism
eclx00340  Histidine metabolism
eclx00380  Tryptophan metabolism
eclx00410  beta-Alanine metabolism
eclx00561  Glycerolipid metabolism
eclx00620  Pyruvate metabolism
eclx00625  Chloroalkane and chloroalkene degradation
eclx00903  Limonene and pinene degradation
eclx01100  Metabolic pathways
eclx01110  Biosynthesis of secondary metabolites
eclx01120  Microbial metabolism in diverse environments
eclx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI66_02935
   00053 Ascorbate and aldarate metabolism
    LI66_02935
   00620 Pyruvate metabolism
    LI66_02935
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI66_02935
   00561 Glycerolipid metabolism
    LI66_02935
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI66_02935
   00310 Lysine degradation
    LI66_02935
   00330 Arginine and proline metabolism
    LI66_02935
   00340 Histidine metabolism
    LI66_02935
   00380 Tryptophan metabolism
    LI66_02935
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI66_02935
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LI66_02935
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LI66_02935
Enzymes [BR:eclx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LI66_02935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJB80360
Position
618865..620280
Genome map
AA seq 471 aa AA seqDB search
MHTIEQIFINGEFVTPHGTERFDLYNPATAQVIGQVRLADEVDAERAIAAAKAAFPAWSQ
TTKQERIAALKRMHAAVAARHDALLEAVIEEYGAPASRSAWMASYPAEVIAQAIEALEAF
EFVTSAGAATVQMTPLGVAGLITPWNSDAGFICGKLAAALAAGCTAVIKPSEMSALQTQI
VTEALRDAALPPGVFNIVTGRGETVGDTISRHPDVAKISFTGSTNTGKAILRNAAESFKR
VTLELGGKSPTILLDDVDLAQAIPLVIQAGFMNSGQACVAGTRILVPYSRKAEIETALAQ
AVAAMKSGDPRNSTTDVGPMVSEKQWLRVQGYIRKGIEEGARLLAGGEGRPEGTRDGWFV
RPTLFAGVNNRMTIARDEIFGPVLCVIPYQDEAEAIAIANDTEYGLSAMVLGGDVDRARR
VAQQIVSGRVLVNTLAHEPKAPFGGFKHSGVGREMGEWGIRAFMEPRSVLG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccatcgaacagatctttattaacggcgagtttgttaccccgcacggtaccgaa
cggtttgatttgtacaatccggcgacggcgcaggtcatcggccaggttcgcctggcggat
gaggttgacgctgaacgcgctatcgcggcggcgaaagcggcgtttccggcgtggtcgcag
accacaaagcaggaacgcatcgccgcgctgaagcgcatgcacgccgccgtggccgctcgt
cacgacgctctgctggaagcggtcattgaagagtacggcgcgcccgcctcgcgctcggcg
tggatggcaagctatccggcagaggtgattgctcaggccatcgaggcgctggaggcattt
gagtttgtcacctccgcaggtgccgcaacggtgcagatgacgccgctcggcgtggccggg
ctgattacgccgtggaacagcgatgcggggtttatctgcggcaaactggcggccgcgctg
gcggcgggctgcacggcggtcatcaagccgagtgaaatgagcgcactgcaaacgcagatt
gtcaccgaagcgctgcgcgacgctgcgctaccgccgggcgtgtttaacatcgtcaccgga
cggggtgagacggtcggtgacacaatcagccgccatccggacgtcgcgaaaatctcgttc
accggttccacgaataccggcaaggcgatcctgcgcaacgcggcggaaagctttaagcgc
gtgacgctggagttgggcggtaaatcaccgacgatcctgctggatgatgtggatctggcg
caggcgatcccgctggtgatccaggccgggtttatgaacagcgggcaggcgtgcgtggcc
gggacgcgcattctggtgccttactcgcgcaaagcggagatcgaaaccgcgctggcgcag
gccgtggcggcgatgaaatccggcgacccgcgcaacagcacgacagacgtcggcccgatg
gtcagcgaaaagcagtggctgcgggtgcagggctatatccgcaaaggaatcgaagaaggg
gcgcgcctgctggcgggcggcgaagggcgaccggaaggcacgcgggacggctggtttgtg
cgtccgacgctgtttgccggcgtgaacaatcggatgaccattgcccgcgacgagattttc
ggcccggtgctgtgcgtaatcccttatcaggacgaggcggaggcgattgccattgccaac
gataccgagtacggcctgagcgcgatggtgctgggcggcgatgtggaccgcgcgcgacgc
gtggcacagcagattgtttccggtcgcgtgctggtgaacaccctggctcatgaaccgaaa
gcgccgtttggcgggtttaagcactccggcgtggggcgcgagatgggcgagtgggggatc
cgcgcgtttatggagccgaggtcggttctgggctaa

DBGET integrated database retrieval system