KEGG   Enterobacter hormaechei subsp. xiangfangensis: LI66_10435Help
Entry
LI66_10435        CDS       T03707                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
eclx  Enterobacter hormaechei subsp. xiangfangensis
Pathway
eclx00620  Pyruvate metabolism
eclx00630  Glyoxylate and dicarboxylate metabolism
eclx01100  Metabolic pathways
eclx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI66_10435
   00630 Glyoxylate and dicarboxylate metabolism
    LI66_10435
Enzymes [BR:eclx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     LI66_10435
    1.2.1.22  lactaldehyde dehydrogenase
     LI66_10435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF1487
Motif
Other DBs
NCBI-ProteinID: AJB81756
UniProt: A0A422XBA4
Position
2169211..2170650
Genome map
AA seq 479 aa AA seqDB search
MTVPVQHPMYIDGQFVAWQGDAWIDVINPATEEVISRIPDGTAEDARKAIDAAERAQAGW
EALPAIERASWLRKISAGIRERVSEISALIVAEGGKIQQLAEVEVNFTADYIDYMAEWAR
RYEGEIIQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVGAGEKIMAA
AAKNITKVGLELGGKAPAIVMDDADLELAVKAIVDSRVINTGQVCNCAERVYVQKGIYDR
FVNRLGEAMKTVQFGNPAERTDIAMGPLINAAALERVEQKVARAVQEGAKVVLGGKAAEG
KGYFYPPTLLLDVRQDMAIMHEETFGPVLPVVAFDTLEEALNMANDSDYGLTSSVYTQDL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLNEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacccgtacaacatcctatgtatattgatggacagtttgttgcctggcagggt
gatgcatggattgacgtgatcaatccggccacggaagaggtcatttcccgtattcccgac
ggcaccgccgaggacgcccgcaaagccattgacgcggcagagcgcgcgcaggctggctgg
gaggcgctgccagccattgaacgcgccagctggctacgcaaaatttccgccgggatccgc
gagcgcgtcagtgaaatcagcgcgttgattgtggccgaaggcggcaagatccagcagctg
gcggaagtggaagtgaactttaccgctgactatatcgactatatggccgagtgggcgcgc
cggtatgaaggggaaatcattcagagcgaccgtccgggcgagaatattctggtgtttaag
cgtgcccttggcgtcaccaccggcattctgccgtggaactttccattcttcctgattgcc
cgtaagcttgctcccgcgctgatcaccggcaacaccatcgttatcaaaccgagcgaattt
accccaaacaacgccattgcgtttgccaaaatcgtcgatgagattggcctgccgaaaggc
gtctttaacctggtgctgggccggggtgaaaccgtcggacaggagctggccgggaatccg
aaagtggcgatggtcagcatgaccggcagcgtcggggcaggtgaaaagatcatggctgcg
gctgcgaaaaacatcaccaaagtggggctggagctgggcggtaaagccccggccatcgtg
atggacgatgccgatcttgagctggccgtgaaggccattgtggattcacgcgtcatcaat
accgggcaggtgtgtaactgcgcggaacgtgtctatgtccagaaggggatctacgaccgc
tttgtgaatcgtctgggcgaggcaatgaaaaccgtccagtttggcaatccggctgagcga
acggatattgccatggggccgctgatcaacgccgccgcgctggagcgcgtggagcagaag
gtggcgcgcgcggtgcaggagggggccaaagtggtccttggcggtaaagcggcagaaggt
aaagggtatttttatcccccaacgctgctgctggacgtgcgtcaggatatggccatcatg
cacgaagagacctttggcccggtgctgccggtggtggctttcgacaccctggaagaggcc
ctgaacatggccaacgacagcgactacggtttaacctcgtctgtttatacgcaggacctg
aacgtcgccatgaaagccattaaggggcttaagttcggcgagacctacattaaccgtgaa
aactttgaagcgatgcagggcttccatgcgggctggcggaaatccggaatcggcggggca
gatggtaaacacggtctgaatgagtatttgcagacgcaggtggtctatttacagtcgtaa

DBGET integrated database retrieval system