KEGG   Enterobacter hormaechei subsp. xiangfangensis: LI66_17990Help
Entry
LI66_17990        CDS       T03707                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
eclx  Enterobacter hormaechei subsp. xiangfangensis
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eclx03016]
    LI66_17990
Enzymes [BR:eclx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     LI66_17990
Transfer RNA biogenesis [BR:eclx03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    LI66_17990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJB83153
UniProt: A0A422XFA7
Position
complement(3763377..3764162)
Genome map
AA seq 261 aa AA seqDB search
MTLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSG
VLLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMDSATLDYPLVEELDKIADKFARDD
KGPQPAVTDYRGMATTELPVATSKFPTTRYSLVELLPKTGRKHQLRRHLAHLRHPIIGDS
KHGDLRQNRSAAEHFGCNRLMLHASELRLTHPFTGEPLTIRAGLDKVWMQALSQFGWLGQ
LPENERVEFAAGNVQDEQQAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgagatcctttatcaggatgagtggttagtggcggtgaataaaccgtccggc
tggctggtgcaccgtagctggctcgatcgcgatgagaaagtggtggtcatgcaaaccgtg
cgcgatcaaatcggtcagcacgtttttactgcccatcgtctcgatcggccaacctctggt
gttctgctgatggggctttccagtgaggccgggcgcctgctggcgcagcagtttgaacag
caccagatccagaaacgctaccacgccatcgtgcgtggctggctgatggattccgccacg
cttgattatcccctggtggaggaactggataaaatcgccgataaatttgcccgcgacgat
aaaggcccgcagccagcggtgaccgactatcgtggtatggcgaccacagaactgccggtg
gcgaccagcaaatttccgaccacgcgatacagtctggtggagcttttgcccaaaaccggg
cgcaagcaccagcttcgccgtcaccttgcacatctgcgccaccccattatcggcgacagc
aagcacggcgatctgcgccagaaccgcagcgcggccgagcactttggctgtaaccggctg
atgctgcacgccagcgagctacgcctgacgcacccgtttaccggcgaaccgctgactatt
cgcgcggggctggacaaggtctggatgcaggcgctgtcacagtttggctggctgggacaa
ctccccgaaaatgaaagggttgagtttgccgcaggcaacgttcaggatgaacagcaagcg
caataa

DBGET integrated database retrieval system