KEGG   Enterobacter hormaechei subsp. oharae: LI66_18285Help
Entry
LI66_18285        CDS       T03707                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eclx  Enterobacter hormaechei subsp. oharae
Pathway
eclx00071  Fatty acid degradation
eclx00280  Valine, leucine and isoleucine degradation
eclx00310  Lysine degradation
eclx00362  Benzoate degradation
eclx00380  Tryptophan metabolism
eclx00620  Pyruvate metabolism
eclx00630  Glyoxylate and dicarboxylate metabolism
eclx00640  Propanoate metabolism
eclx00650  Butanoate metabolism
eclx00900  Terpenoid backbone biosynthesis
eclx01100  Metabolic pathways
eclx01110  Biosynthesis of secondary metabolites
eclx01120  Microbial metabolism in diverse environments
eclx01130  Biosynthesis of antibiotics
eclx01200  Carbon metabolism
eclx01212  Fatty acid metabolism
eclx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI66_18285
   00630 Glyoxylate and dicarboxylate metabolism
    LI66_18285
   00640 Propanoate metabolism
    LI66_18285
   00650 Butanoate metabolism
    LI66_18285
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI66_18285
   00072 Synthesis and degradation of ketone bodies
    LI66_18285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI66_18285
   00310 Lysine degradation
    LI66_18285
   00380 Tryptophan metabolism
    LI66_18285
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI66_18285
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI66_18285
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI66_18285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclx04147]
    LI66_18285
Enzymes [BR:eclx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI66_18285
Exosome [BR:eclx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI66_18285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJB83209
UniProt: A0A0W1X843
Position
complement(3829850..3831028)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGIAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWELSDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatctcggcagcgtggtggtaagagcgctggtggaacgc
agcgggattgccgcacatgaaattgatgaggtgatccttggccaggtgctgaccgctggc
gcgggacaaaaccctgcgcgccaggcagcgctgaagggcggcctgcccaatacagtttcg
gcaattaccatcaacgacgtctgtggttcaggtttgaaagcgctccatcttgcgacgcag
gccatccagtgcggtgaagcggacgtggttattgccggcgggcaggagaatatgagccgc
gccccgcacgtcctgaccgacagccggaccggcgcgcagctcgggaacagtcagctgctt
gacagtctggttcacgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggtatcagccgcgagcttcaggatgcatatgccctc
agctcacaacaaaaagcgcgtgcagcgatcgactccgggcgttttcgcgatgaaattgtc
ccggtcagtacccagcgccagaacggcgaagcgctcatcgtcgataccgacgagcagccg
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggcctttgaaacgctcggt
tctgtaacggcaggcaacgcctcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcgcatcaaagcgtttgcc
agcgtgggtgttgatcctgcgttaatggggatcgccccggtctatgccacgcgccgctgc
ctggagcgggcgggctgggagctgagcgatgtggatctgattgaggtcaacgaagccttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggtgcaattgcgctgggtcatcccattggcgcctccggctgccgcattctggtg
tcgctggtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgtatt
ggcggagggcagggggtggccctggctatcgaacggtag

DBGET integrated database retrieval system