KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_13165Help
Entry
LI62_13165        CDS       T03708                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Pathway
ecly00052  Galactose metabolism
ecly00500  Starch and sucrose metabolism
ecly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI62_13165
   00500 Starch and sucrose metabolism
    LI62_13165
Enzymes [BR:ecly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LI62_13165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AJB62953
UniProt: A0A0E1JAW4
Position
complement(2393731..2395137)
Genome map
AA seq 468 aa AA seqDB search
MTLSSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWWHDGLWYMVLGAQDRQ
QRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFELDGTHILICCPQGLAR
EAHRYLNTYPAVWMRGAFDYQTPAFAHGELHELDAGFEFYAPQTTVAEDGSRILIGWMGV
PDGEEMLQPTRVHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHLWQGRASDAPVL
AGARLEFELSASSVNVDFAGALRLIVDDEGIRLERASLKTTDTLTRYWQGNVHHLRVLCD
CSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatcttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccgcgt
gcgctggcggacagccactatccgcagtggcatcccgcaccggtgacagggctgatgaac
gatccgaacgggtttatctggtttgccgggcgctaccatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgttgggggcactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaatggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgatggcacg
tttgccaaactgggaccggtgttgcccctgccggacgggtacaccgggcacgtccgcgat
ccgaaagtatggtggcatgacgggctgtggtacatggtgctcggcgcgcaggatcgacag
cagcgcggcaaggtgctgctgtttacgtcagccgatttacacacctgggcgtcctgcggc
gaaatcgccggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgagcttgatggcacacacatcttgatctgctgcccgcaggggctggcgcgc
gaagcgcatcgctatctcaacacctatccggccgtctggatgcgtggggcatttgattat
caaacgcctgcatttgcgcacggcgagctgcatgagcttgacgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggcagccgcatcctcatcggctggatgggcgtg
ccggacggcgaagagatgctccagcctacgcgggtgcacggttggatccaccagatgacc
tgtcctcgcgagctgcgctaccgcgacggtaagctctggcaaacccccgtccgtgagctg
gaaacgctgcgcgaggatgaacatctctggcagggacgcgccagcgatgccccggtgttg
gcgggagcgcgtcttgaattcgaactgagcgcatcgagcgtgaacgtggattttgccggc
gcgttgcggctgattgtggatgatgaggggatccgtctggaacgcgccagtctgaaaacc
acagacacgctgacccgctactggcagggcaatgttcatcatttacgcgtgctgtgcgac
tgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggtacgcttcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system