KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_18330Help
Entry
LI62_18330        CDS       T03708                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecly03009]
    LI62_18330 (rluD)
Enzymes [BR:ecly01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LI62_18330 (rluD)
Ribosome biogenesis [BR:ecly03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LI62_18330 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N S4_2
Motif
Other DBs
NCBI-ProteinID: AJB63911
Position
complement(3516693..3517673)
Genome map
AA seq 326 aa AA seqDB search
MAQRVELTATVSENQLGQRLDQALAELFPDYSRSRIKEWILDQRVLVNGKIWDKPKEKVF
GGEAVAINAEIEEEVRFEPQDIPLDIVYEDDDILVINKPRDFVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQLREITREYEAVAIGHMT
SGGTVEEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHFRIHTRLRLRLETGRTHQIRVHM
AHITHPLVGDPVYGGRPRPPKGASDEFISVLRKFDRQALHATMLRLYHPITGIQMEWHAP
IPQDMVELIDAMRADFEEHKDHVDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtagaactcaccgcaacagtctccgaaaatcagctcggtcaacgctta
gatcaggctttggccgaattgttccctgattattcgcgttcacgcataaaagaatggatc
cttgaccagcgcgtgctggtaaacggcaagatctgggacaaaccaaaagagaaagtgttt
ggtggggaagctgtcgccatcaatgctgaaatcgaagaggaagtccgcttcgagccgcag
gatatcccgctggatatcgtctacgaagatgacgatattctggtcatcaacaagccgcgc
gactttgttgttcatccgggcgcgggcaatcctgacggtacggtacttaacgctctcctt
cattattatccaccgattgccgacgtaccgcgtgccggtatcgttcaccgtctggataaa
gacaccacgggtctgatggtggtggcgaagacggtcccagctcagactcgcctggtggaa
tctttgcaattgcgcgaaattacccgtgagtatgaagcggtggcgattggtcatatgacc
tctggcggcacggtggaagagcctatcagccgtcacccaaccaagcgtacgcatatgtcc
gtacacccgatgggtaaaccggcggtaacccactaccgcatcatggaacatttccgtatt
catacgcgcctgcgtctgcgtctggaaaccgggcgtactcaccagatccgcgtgcatatg
gcgcatattacccatccgctggtgggtgacccggtttacggcggtcgtccgcgtccacca
aagggcgcatcggatgaattcatctccgtgctgcgtaaattcgatcgccaggcgctgcat
gcgacgatgctgcgtctttaccacccaatcaccggaattcagatggaatggcatgcgccg
atcccacaggatatggtggaacttatcgacgcgatgcgcgcagatttcgaagaacataag
gatcacgtggactggttatga

DBGET integrated database retrieval system