KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_19745Help
Entry
LI62_19745        CDS       T03708                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Pathway
ecly00071  Fatty acid degradation
ecly00280  Valine, leucine and isoleucine degradation
ecly00310  Lysine degradation
ecly00362  Benzoate degradation
ecly00380  Tryptophan metabolism
ecly00620  Pyruvate metabolism
ecly00630  Glyoxylate and dicarboxylate metabolism
ecly00640  Propanoate metabolism
ecly00650  Butanoate metabolism
ecly00900  Terpenoid backbone biosynthesis
ecly01100  Metabolic pathways
ecly01110  Biosynthesis of secondary metabolites
ecly01120  Microbial metabolism in diverse environments
ecly01130  Biosynthesis of antibiotics
ecly01200  Carbon metabolism
ecly01212  Fatty acid metabolism
ecly02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI62_19745
   00630 Glyoxylate and dicarboxylate metabolism
    LI62_19745
   00640 Propanoate metabolism
    LI62_19745
   00650 Butanoate metabolism
    LI62_19745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI62_19745
   00072 Synthesis and degradation of ketone bodies
    LI62_19745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI62_19745
   00310 Lysine degradation
    LI62_19745
   00380 Tryptophan metabolism
    LI62_19745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI62_19745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI62_19745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI62_19745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecly04147]
    LI62_19745
Enzymes [BR:ecly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI62_19745
Exosome [BR:ecly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI62_19745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJB64173
UniProt: A0A0E1JEE2
Position
complement(3815481..3816659)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGIAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWELNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatcttggcagcgtggtggtaagagcgctggtggaacgc
agcgggattgccgcacatgaaattgatgaggtgatcctgggccaggtgctgaccgctggc
gcgggacaaaaccctgcgcgccaggcggcgctgaagggcggcctgcctaataccgtttcg
gcaattaccatcaacgacgtctgtggttcaggtttgaaagcgctccatcttgcaacgcag
gccatccagtgtggtgaagcggatgtggtcattgccggcgggcaggagaatatgagccgc
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcgggaacagtcagctgctt
gacagcctggttcacgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggtatcagccgcgagcttcaggatgcatatgccctc
agctcacagcaaaaagcgcgtgcagcgatcgactccgggcgttttcgcgatgaaattgtc
ccggtcagtacccagcgccagaacggtgaagcgctcatcgtcgataccgacgagcagccg
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggcctttgaaacgctcggt
tccgtaacggcaggcaacgcctcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcggatcaaagcgtttgcc
agcgtgggcgttgatcccgcgttaatggggatcgccccggtctatgccacgcgccgctgc
ctggagcgggcgggctgggagctgaacgatgtggatctgattgaggtcaacgaagctttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggagccatcgcgctgggccatcccattggcgcctccggctgccgcattctggtg
tcgctggtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgtatt
ggcggggggcagggggtggccctggctatcgaacggtaa

DBGET integrated database retrieval system