KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_06750Help
Entry
LI64_06750        CDS       T03709                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00020  Citrate cycle (TCA cycle)
eclz00640  Propanoate metabolism
eclz00660  C5-Branched dibasic acid metabolism
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01200  Carbon metabolism
Module
eclz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eclz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI64_06750 (sucC)
   00640 Propanoate metabolism
    LI64_06750 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LI64_06750 (sucC)
Enzymes [BR:eclz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LI64_06750 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AJB70265
Position
1394481..1395647
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVAIDPLAGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITTQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggccaaacagctgtttgcccggtatggcttaccggctccg
gtgggttatgcctgtactaccccgcgtgaagcagaagaagccgcatctaaaatcggttcc
ggcccgtgggtagttaagtgtcaggttcacgctggtggccgtggtaaagcgggcggtgtg
aaggttgttaagagcaaagaagagattcgtgcgtttgctgaacattggctcggcaagcgt
ctggtgacctaccagacagatgcgaacggccagccggttaaccagatcctggtggaagcg
gcgaccgacatcgcgaaagaactgtacctgggcgcggttgttgaccgtagctcccgtcgc
gtggtgttcatggcgtctaccgaaggcggcgtggaaatcgaaaaagtggcggaagagacc
ccacacctgatccacaaagtggctatcgatccgctggcaggcccaatgccttaccagggt
cgcgagctggcattcaaactgggtctggaaggtaaactggttcagcagttcaccaagatc
ttcatgggtctggcaacgatcttcctggagcgcgatctggcgctgatcgagatcaacccg
ctggtgatcaccacccagggcgacctgatctgcctcgacggcaaactgggcgctgacggc
aacgccttgttccgccagccggatctgcgcgaaatgcgcgaccagtctcaggaagatccg
cgtgaagcgcaggctgcacagtgggagctgaactacgtggcgctggatggcaacatcggc
tgcatggttaacggtgcgggcctggcaatgggcaccatggacatcgttaagctgcacggc
ggtgagccggcaaacttcctcgacgtgggcggtggcgcaaccaaagagcgcgtaaccgaa
gcgttcaaaatcatcctctctgacgacaacgttaaagcggtactggttaacatcttcggc
ggcatcgtccgttgcgacctgattgctgacggcattatcggtgcggtagaagaagtgggt
gttaacgttccggttgtggttcgtctggaagggaacaacgctgaactcggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system