KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_07640Help
Entry
LI64_07640        CDS       T03709                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00260  Glycine, serine and threonine metabolism
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LI64_07640
Enzymes [BR:eclz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LI64_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJB70425
Position
complement(1578425..1579426)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAPDGSLPLDKVAAKI
KADDIHFARTKLLSLENTHNGKVLPREYLKAAWDFTRERKLGLHVDGARIFNAVVEYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNADYIRRANRWRKMTGGGMRQAGILAAAGLY
ALKNNVSRLKDDHDNAAWMATQLREIGADVMRHDTNMLFVRVGDEHAAALGEFMKARGVL
INASPVVRLVMHLDVNREQLTEVVKHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgtagtgataccgttacccgtccgggccgtgccatgctcgaagagatg
atggccgccccggtcggggacgacgtctacggcgatgacccgacggtcaacgaactccag
cgttatgcggcagaactgagcggtaaagaagccgccctgttcctgcccactggcacgcag
gctaacctggtggcgctgctcagccactgcgagcgcggcgaagagtatatcgtcggccag
ggggcgcataactacctgtacgaagctggcggtgcggcggtgctcggcagcatccagcca
cagccgattgatgccgcgccggacggctctctgccgctggataaagtcgcggcaaaaatc
aaagccgacgatattcacttcgcccgcaccaaactgctcagcctcgaaaacacccataac
ggtaaagtcctgccgcgcgaatacctcaaggccgcatgggactttacccgcgagcgcaag
ctcggcctgcacgttgacggcgcacgaatctttaacgccgtggtggagtatggctgcgag
ctgaaagagatcacccaatattgcgactcgttcaccatttgcctttctaaaggtctgggt
acgccggtgggctctctgctggtgggcaatgcggactacatcaggcgcgccaaccgctgg
cgtaaaatgaccggcggcggcatgcgtcaggcgggtattctggcggctgccggactctac
gccctgaaaaataacgtgtctcgcctgaaagacgatcacgacaatgcggcgtggatggca
acgcagttgcgtgaaatcggcgctgatgtcatgcgtcacgacactaacatgctgtttgtg
cgcgtgggagacgagcatgctgccgcgctgggcgaatttatgaaggcccgtggcgtgctg
atcaacgcctccccggtcgtgcgactggtgatgcatcttgacgttaaccgtgagcagttg
accgaggtggtgaaacactggcaggcgtttttacagcgttaa

DBGET integrated database retrieval system