KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_08845Help
Entry
LI64_08845        CDS       T03709                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13069  diguanylate cyclase [EC:2.7.7.65]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI64_08845
Enzymes [BR:eclz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     LI64_08845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF GAF_2 GAF_3 Autoind_bind
Motif
Other DBs
NCBI-ProteinID: AJB70647
Position
complement(1832366..1833394)
Genome map
AA seq 342 aa AA seqDB search
MSDIILARVSETLSTEQSLDSLVRQLLEMLEIVTDMESTYLTKIDINARLQHILYARNSK
QMQIPEGFSVPWDETLCKRAIDSDTVFSNEVPERWPECEAAKALGITTYMSVPVHLADGS
LYGTLCAASTAQKQFSERGEQVIRLFAGLIGQYIQKESLVLQLREANAALIAHSYTDALT
GLPNRRAIFENLTTLFSLARHLNRKVMMAFIDLDDFKRINDQYGHEAGDRFLVQVGRRLT
HEQTQDEIIGRLGGDEFLVASLSHGDDGDASTEVNAIKTRLNSRIAGEYGLGNATILYPG
ASLGVVIVDPHSTDEDSALRTADLAMYQDKKGKSKTGFVALD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatcattcttgcccgtgtttcagaaaccctctccactgagcaatctctcgac
agtctggtgcgtcagctactggaaatgctggaaattgtgacggatatggaatcaacctac
ctgacgaaaatcgatattaatgcgcgtttgcagcatatattgtacgcccgtaacagcaag
caaatgcagatcccggaagggttcagcgtgccctgggacgaaacgctgtgtaagcgcgcc
attgatagcgatacggtgttcagtaacgaggtgcccgaacgctggccggagtgtgaagcg
gcaaaagcactgggtattacaacctatatgagcgtgccggttcatcttgcggacggttct
ctgtacggcacgctttgcgctgccagcaccgcgcaaaaacagttcagcgagcgtggcgag
caggtgatcagactctttgccgggttaattggtcagtacatccagaaagagtcgcttgtg
cttcagcttcgcgaagcaaacgcggcgctcattgcccactcttacaccgacgccctcacc
ggcctgccgaatcgccgcgctatttttgaaaatctcaccaccctgttctcactggcgcgc
caccttaaccgcaaggtcatgatggcctttattgacctcgatgatttcaagcgaatcaat
gaccagtacgggcatgaggcgggcgatcggttcctcgtacaggtcggcaggcgactgacg
cacgagcaaacgcaggatgagattatcggccgactcggcggcgatgaatttctggttgcc
agcctgagtcacggcgatgatggcgacgccagcacagaggtcaacgcaatcaaaacccgc
ctcaatagccgcattgcgggtgaatacgggttaggtaatgccactattctctatcctgga
gcaagccttggcgtcgttatcgttgatcctcacagcactgatgaagatagcgccctgcgc
accgcagacctcgcgatgtatcaggataaaaaagggaaaagcaaaacaggctttgtcgcg
ttagattaa

DBGET integrated database retrieval system