KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_09245Help
Entry
LI64_09245        CDS       T03709                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00480  Glutathione metabolism
eclz00590  Arachidonic acid metabolism
eclz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LI64_09245 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LI64_09245 (btuE)
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LI64_09245 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJB70717
Position
1913483..1914034
Genome map
AA seq 183 aa AA seqDB search
MQSDILNTEVTTIDGEKTTLEGYKGKVLLIVNAASKCGLTPQYEQLENIHKAWEKDGFTV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPMFSKIDVNGEDRHPLYAKLVAAAPTAVA
PEESGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgatattctgaataccgaagtgacgaccattgacggcgagaaaaccacgctg
gaaggctacaagggcaaggtgctgctcatcgtgaacgcggcgtcgaaatgtggcctgacg
ccgcagtatgaacagctggaaaacattcataaagcctgggaaaaagacggctttaccgtc
ctcggcttcccgtgcaaccagttcctgggccaggagccgggcagcgaagaggagattaag
accttttgcagcacaacctatggcgtgacgttcccgatgttcagcaaaattgacgtgaac
ggggaagaccgtcatccgctgtacgccaaactggtggccgcggcgccgaccgccgttgcg
cctgaagagagtggtttctatgagcgaatggcgagtaaaggccgcgcgccgctctatccg
gacgatattctgtggaacttcgaaaaattcctgattggccgtgacggtcaggtcgtgcag
cgtttttcgccggacatgacgcctgaagatcctatcgtgatggaatctatcaagctggcg
ctggcgaaataa

DBGET integrated database retrieval system