KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_09320Help
Entry
LI64_09320        CDS       T03709                                 

Definition
(GenBank) BglX
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00460  Cyanoamino acid metabolism
eclz00500  Starch and sucrose metabolism
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LI64_09320
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    LI64_09320
Enzymes [BR:eclz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     LI64_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like DUF11 DUF4232 CARDB
Motif
Other DBs
NCBI-ProteinID: AJB70731
Position
1930304..1932679
Genome map
AA seq 791 aa AA seqDB search
MTAIYKDAGRPVHERVADLLARMSPEEKFAQMHAYWLILDENGNHRERSDLSDEFAGVSE
QASLSERLKLGVGQITRPLGTHIVDAKTGVRAANRLQRMMMEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDPALVQRAAEQIGKEARSVGCQQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGVMATAYVKGLQGDKRDLLATLKHYVGHSFSEGARNHAPVHLGFSELNDTF
LLPFEMAVKLANAGSVMPAYHDIDNQPGHSDHFLLTTVLREQWGFDGIIVADYGGVSLLH
QHHGVSHDPAESAALAFNAGLDVELPKDDCARHLAEAVERGLISMAKVDEIVARVLSEKF
RLGLFEKPYADEDSIDLQNEATRQVAREVATKSITLLENNGILPLNGKPRVAVVGPTADD
PLALLSGYSFPVHLIISDMVEETSQVTTPRAALEQYLGASQIRYAKGCHIIEKRMAGAPV
FPGDSGGKPMQQSPVSQRTDLIPDAVSAAQESDVVVACVGDLAGLFQSGTVGEGSDTDSL
DLPGVQQQLLEALVATGKPVIVVMTGGRPYNLQGLEDKVAALMLAWAPGQEGGWAIADVL
TGRAEPQGRLVVSVPKSAGAMPYYYNHKLKSGGTPFAFHFGALYPFGYGLGWTQFSWGAA
RLAESRVPVGGEVVLNVDITNTGERSGSEVVQVYVRDKVATQVRPLQELKAFQRVTLSPG
ETATLTFTLPVEMFNFTRRDGKRIVEPGEFELQVGASSADIREAVTVQVTGETRVLAGEW
RMLSRCDMTRA
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgacggctatctataaggacgcgggacgtcccgtacatgagcgtgtcgccgatttactg
gcgcgtatgagccctgaagagaaattcgcccagatgcacgcgtactggctgatcctcgac
gaaaatggcaaccatcgcgagcgcagcgatttgagcgatgaattcgccggtgtgagcgaa
caggcgtccctcagcgaacggctgaagctgggtgtcggccagatcacccgaccgctcggc
acgcacattgtggatgcaaaaaccggcgtgcgagccgccaaccgtctgcaacgcatgatg
atggaggagacccggctcggcattccggcgctgtttcatgaggagtgtctggtggggctg
ctgtgcaaagatgcaacgctgttcccgtcgtcgctgaactacggttccacctgggatccg
gcgctggtacagcgcgcagcggagcagatcggcaaagaggctcgatccgtcgggtgtcaa
caggggctggccccggtgctggacgtttcccgcgacgtgcgctgggggcgtacggaagag
accttcggtgaagatccgtggctggtgggggtgatggccaccgcctacgtcaaaggcttg
cagggtgataagcgcgatctgctggcgaccctgaaacactacgtcggccactccttcagc
gaaggggcgcgcaaccatgcgccggtccatctcggtttcagcgagctaaacgataccttc
ctgctgccctttgaaatggcggtcaagctggcgaacgccggttcggtgatgcccgcctat
cacgacattgataatcagccagggcacagcgaccacttcctgctcaccaccgtactgcgt
gaacagtggggcttcgacggtattatcgtggcggattacggcggcgtcagcctgctgcac
cagcaccacggggtttctcacgatcccgcggaatcagcggcgctggcgtttaacgccggg
ctggacgtggaattgccaaaagatgactgcgcgcgtcatctggcggaagcggtagagcgt
gggcttatttcgatggcgaaagtggatgagattgtggcgcgtgtgctgagtgaaaaattc
cgcctcgggctgtttgaaaaaccgtacgccgacgaagacagtattgatttgcagaatgag
gcgacgcggcaggtagcgcgcgaggtggcaacaaaatcgataacgctgctggaaaacaac
ggcattttgcccctcaacgggaaacctcgtgtagcggtagtggggccaacggcagacgat
ccgctggcgctgctgagcggctacagcttcccggtgcacctgatcatcagcgatatggtt
gaagagacctcgcaggtgactactccgcgcgcggcgctggaacagtatcttggtgcatcg
cagatacgttacgccaaagggtgtcacattatcgaaaaacggatggcgggcgcgccagtc
tttcctggcgacagcggcggtaaaccgatgcagcagtcgccggtttcacaacgcacggat
ctgatccccgacgccgtaagcgcggcgcaagagagtgacgtggtggtggcctgcgtcggt
gacctcgccggactattccagagcggcaccgtgggggaaggatcggataccgattcgctg
gatctgccgggcgtgcagcaacagctgctggaggcgctggtggcaaccggtaagccggtg
attgtcgtcatgacgggcgggcgaccttataaccttcaggggctggaagataaggtggcc
gcgctgatgctggcctgggcgccggggcaggaaggaggctgggcgattgccgatgtctta
accggtcgtgcggagccgcagggcaggctggtcgtgagcgtaccgaaaagcgccggggcg
atgccgtactactacaaccacaagctgaaaagcggcggcacgccgtttgcgttccatttt
ggcgcactttacccgttcggttacggtctcggctggacgcagtttagctggggcgcggcc
cgcctggctgaaagtcgcgtcccggtcggcggagaggtggtgttaaacgtcgatatcacc
aacaccggggagcgcagcggcagtgaagtggtgcaggtgtatgtgcgcgataaggtcgcc
acgcaggtgcgtccgcttcaggagctgaaagcgttccagcgcgttacgctttcaccagga
gaaaccgccacgctgacctttaccctgccggtagagatgttcaatttcacgcgccgggac
gggaagcgaatcgtcgagccaggggaatttgagctacaggttggcgcgtcctcggcggat
attcgcgaggcagtaacggtacaggtaaccggagagacgcgggtgctggcgggggagtgg
cgaatgctcagtcgctgtgacatgacccgggcgtaa

DBGET integrated database retrieval system