KEGG   Enterobacter cloacae 34983: LI64_11130Help
Entry
LI64_11130        CDS       T03709                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eclz  Enterobacter cloacae 34983
Pathway
eclz00052  Galactose metabolism
eclz00500  Starch and sucrose metabolism
eclz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LI64_11130
   00500 Starch and sucrose metabolism
    LI64_11130
Enzymes [BR:eclz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LI64_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AJB71067
Position
2314117..2315523
Genome map
AA seq 468 aa AA seqDB search
MTLTSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWRHDGRWHMVLGAQDRQ
KRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTFPAVWMSGAFDYQTSAFAHGELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTRAHGWIHQMTCPRELRYRDGKLWQTPVRELETLRESEHHWQGRADAAPEL
DGARLEFELSTSRVNVDFAGALRLVVDDEGLRLERASLKTGETLTRYWRGHVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaacttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccccgt
gcgctggcggacagccattatccgcagtggcatcccgcgccggtgacggggttgatgaac
gatccgaacggatttatctggttcgccggacgctaccatctgttttatcagtggaacccg
ctgggctgcgaccatcgctataagtgctggggacactggagctcagcagatctggtgcac
tggcagcacgaaccaatggcgctgatgcccgacgaagagtacgaccgcaacggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctacaccggtaacgttaag
tttgacgatggtggccgcaccgcctggcagtgtctggcggtgcaaaatgacgatggcacg
tttgccaaactggggccggtattgcccctgccggacgggtacaccgggcacgttcgggat
ccgaaagtgtggcgccatgacgggcggtggcacatggtgcttggcgcgcaggaccggcaa
aagcgcggcaaagtgctgctgtttacgtcagccgatttgcacacctgggcgtcctgcggc
gaaatcgccggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgcgctggatggcacacacgtcttgatctgctgcccacaagggctggcgcgc
gaaccgcatcgctatctcaatacctttccggcagtctggatgagtggggcatttgattat
caaacgtctgcatttgcgcacggcgaactgcatgagcttgacgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcattggctggatgggcgtg
ccggacggcgaggagatgctccagcctacgcgggcgcacggctggatccaccagatgacc
tgtccacgggagctgcgctaccgcgacggtaagctctggcaaacgccggtacgtgagctg
gaaacgctgcgcgagagtgaacatcactggcagggccgcgccgacgctgcgccggaactg
gatggggcacgccttgagtttgaactgagcacttcacgcgtgaatgtggattttgccggt
gcgttgcgtctggttgtggatgacgaggggctacgtctggaacgcgccagcctgaaaacc
ggagagacgttgacccgctactggcggggccatgttcatcatttacgcgtcttgtgtgac
cgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggctcaggtgcgcttcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system