KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_11530Help
Entry
LI64_11530        CDS       T03709                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00250  Alanine, aspartate and glutamate metabolism
eclz00650  Butanoate metabolism
eclz00760  Nicotinate and nicotinamide metabolism
eclz01100  Metabolic pathways
eclz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LI64_11530
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI64_11530
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LI64_11530
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     LI64_11530
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     LI64_11530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJB71140
Position
complement(2407522..2408904)
Genome map
AA seq 460 aa AA seqDB search
MTYSSATHALSVNPATGETLAAYPWATSWDVERAIAQADTGFRQWRRESVAHRAQKLRDL
GTALRSRAEAMAQTISREMGKPIVQARAEVAKSASLCDWYAEHGPAMLHPESTQVENAVI
EYRPLGPILAVMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVLGSAEMIGQVFADAGFP
EGVFGWVNATNDGVSQAINDRRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDPFI
VLNDADLDLAVNAAVAGRYQNTGQVCAAAKRFIVEAGVADVFTRRFVDAVAALKMGAPEE
EDNYIGPMARCDLRDELHQQVQATLAEGATLLLGGEKIAGSGNYYAPTVLGNVTPEMTAF
RQELFGPVAAITVAKDAAHALQLANDSDFGLSATVFTANDALAETFSRELECGGVFINGY
SASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKDRV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacttattcatctgctacccatgccctttctgtcaatccggctaccggcgaaacgctg
gctgcttacccgtgggccacgtcctgggatgttgaacgtgccattgcgcaggcggatacc
ggttttcgccagtggcgacgcgagagcgtagcgcaccgggcgcaaaaacttcgcgatctg
ggtacggcgctgcgtagccgtgcggaagcgatggcgcagacaatctcccgggagatgggt
aagccgattgtgcaggcgcgtgcggaggtagcgaagtccgccagcctttgcgactggtac
gctgaacacggcccggcgatgctgcacccggaatctacccaggtcgaaaatgcggtgatt
gagtaccgcccgctggggccgattctggcggtgatgccgtggaacttcccgctgtggcag
gtgctgcgcggtgcggtgccgatcctgctggcagggaacagctatctgcttaaacatgcg
ccgaatgtgctcggctcggcggagatgatcgggcaggtgtttgcggatgccggtttccct
gagggggtctttggctgggtgaacgcgacaaatgacggcgtcagccaggcgattaacgat
cgtcgtatcgcggcggtgaccgtgaccggcagcgttcgggcaggggcggcgattggcgcg
caggcgggcgcggcgctgaagaaatgcgtgctggagctgggcggttccgatccgtttatc
gttctgaacgatgccgatctggatctggcggtcaacgcggccgtggccggacgttatcag
aataccgggcaggtttgcgcggcggcaaaacgctttattgtggaagcgggcgtggcggac
gtctttacccggcgctttgtcgacgcggtcgcggcgctgaagatgggcgcaccggaagaa
gaagataactatattggcccaatggcgcgatgtgatcttcgcgatgaactgcatcagcaa
gtgcaggctacgctggcggaaggggcgaccctgctgctgggcggagagaagattgccggg
agcggtaactattatgcgccaaccgtactcgggaacgtcaccccagagatgacggccttc
cgtcaggagctgtttggcccggtggccgcgattaccgtcgcgaaagatgcggcgcacgcc
ttgcagctggctaatgacagcgattttggcttatcggcgacggtctttaccgcgaacgat
gcgctggctgaaaccttctctcgcgaactggagtgcggcggggtgtttatcaacggctac
agcgccagcgatgcgcgcgtcgcgtttggcggcgtgaagaagagcggcttcggacgggag
ctttctcatttcggtctgcatgagttctgtaatgtgcagacggtgtggaaggatcgcgtg
taa

DBGET integrated database retrieval system