KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_12080Help
Entry
LI64_12080        CDS       T03709                                 

Definition
(GenBank) S-adenosylmethionine tRNA ribosyltransferase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI64_12080
Enzymes [BR:eclz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     LI64_12080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AJB71243
Position
complement(2518756..2519637)
Genome map
AA seq 293 aa AA seqDB search
MSDTTYAVIYDLHSHTQASDGLLTPEALVHRAVEMRVGTLAITDHDTTDGIPAARAEIAR
SGLALNLVPGVEISTVWENHEIHIVGLNIDTEHPAMRAFLQEQKTRRNQRAEMIGERLEK
AHIPGALEGAQKLANGGAVTRGHFARFLVETGKATTMANVFKKYLARGKTGYVPPQWCTI
KQAIDVIHHSGGKAVLAHPGRYNLSAKWLKRLLAHFAECGGEAMEVAQCQQAPNERSQLA
TYARQFGLLGSQGSDFHQPCAWIELGRKLWLPAGVEPVWQLWEQPQQIEEREV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgataccacctacgccgtaatttatgatttacacagccatacgcaggcttcagat
ggcctgctgacacccgaagccctggtccatcgtgccgttgaaatgcgtgtcggcacgctg
gcgataaccgatcacgataccactgacggcattcccgccgcgcgcgccgagattgcccgc
agcgggctggcgctgaatctggtgcccggggtcgagatctcgacggtctgggaaaaccac
gaaattcatatcgttggcctgaacatcgatacagaacatccggcaatgcgggcttttttg
caagaacaaaaaacacgccgcaatcaacgcgcggagatgattggcgaacgtctggaaaaa
gcgcatattcccggtgcgctggaaggcgcgcaaaagctggcgaacggcggggcggtaaca
cgcggccatttcgcccgttttctggttgaaaccggtaaggcaacgaccatggcaaatgtc
tttaaaaagtatctggcgcgcgggaaaaccggatacgttcccccacagtggtgtacaata
aaacaagctattgatgtgattcatcattctggcggtaaggccgtactggcccatccgggg
cggtataatctttctgctaaatggctgaaaagactgctggcgcactttgccgaatgcggc
ggtgaggcgatggaagttgcccagtgccagcaggcacccaatgagcgttcgcagctcgcg
acctacgcccgtcagtttggcctgcttgggtcacagggttcagatttccatcagccctgc
gcgtggattgaactggggcgcaagctctggttacccgctggcgttgagcctgtctggcag
ctctgggaacagccacagcaaattgaagagagggaagtatga

DBGET integrated database retrieval system