KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_17190Help
Entry
LI64_17190        CDS       T03709                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00071  Fatty acid degradation
eclz00280  Valine, leucine and isoleucine degradation
eclz00310  Lysine degradation
eclz00362  Benzoate degradation
eclz00380  Tryptophan metabolism
eclz00620  Pyruvate metabolism
eclz00630  Glyoxylate and dicarboxylate metabolism
eclz00640  Propanoate metabolism
eclz00650  Butanoate metabolism
eclz00900  Terpenoid backbone biosynthesis
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01200  Carbon metabolism
eclz01212  Fatty acid metabolism
eclz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI64_17190
   00630 Glyoxylate and dicarboxylate metabolism
    LI64_17190
   00640 Propanoate metabolism
    LI64_17190
   00650 Butanoate metabolism
    LI64_17190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI64_17190
   00072 Synthesis and degradation of ketone bodies
    LI64_17190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI64_17190
   00310 Lysine degradation
    LI64_17190
   00380 Tryptophan metabolism
    LI64_17190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI64_17190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI64_17190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI64_17190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclz04147]
    LI64_17190
Enzymes [BR:eclz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI64_17190
Exosome [BR:eclz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI64_17190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJB72178
Position
complement(3637700..3638878)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGIAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSILRHNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcattctgcggttgatcttggcagcgtggtggtaagagcgctggtggaacgc
agcgggattgccgcacatgaaattgatgaggtgatcctgggccaggtactgactgctggc
gcgggacaaaaccctgcacgccaggcggcgctgaagggcggcctgcctaacaccgtatcg
gcgatcaccatcaacgacgtctgtggttcaggtctgaaagcgcttcatcttgcgacgcag
gccatccagtgcggtgaagcggacgtggtcattgccggtggacaggagaatatgagccgc
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcgggaacagtcagctgctt
gacagcctggttcacgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggagaacctggcgcgggaatacggcatcagccgcgagcttcaggatgcgtatgccctt
agctcgcagcaaaaagcgcgtgcggcgatcgactccggccgttttcgcgacgaaattgtc
ccggtcagtattctgcgccataacggagaagcgcttatcgtcgataccgacgagcagccg
cgtaccgatgccagtgcagaagggctggcaaaactcgatccggctttcgaaacactgggc
tctgtgacggcaggcaacgcttcatcgattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcggatcaaagcgtttgcc
agcgtgggcgttgatcccgcgttaatggggatcgctccggtctatgccacgcgccgctgt
ctggagcgggcgggttggcagctgaacgatgtggatctgattgaagtcaacgaagctttt
gctgcgcaggcaatctcggtcggaaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggtgcaatcgcgctgggtcatcccattggcgcctctggctgccgcattctggtg
tcgttagtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgcatt
ggcggagggcagggggtggccctggcgatcgaacggtag

DBGET integrated database retrieval system