KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_17500Help
Entry
LI64_17500        CDS       T03709                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00010  Glycolysis / Gluconeogenesis
eclz00030  Pentose phosphate pathway
eclz00051  Fructose and mannose metabolism
eclz00680  Methane metabolism
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01200  Carbon metabolism
eclz01230  Biosynthesis of amino acids
Module
eclz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eclz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
eclz_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI64_17500
   00030 Pentose phosphate pathway
    LI64_17500
   00051 Fructose and mannose metabolism
    LI64_17500
  09102 Energy metabolism
   00680 Methane metabolism
    LI64_17500
Enzymes [BR:eclz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LI64_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MR_MLE_C S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: AJB72239
Position
complement(3695439..3696518)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGAAFIAGKGVKTDIPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSKYLARMSKMGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSSAQEIKDSVSYGVVKMNIDTDTQWATWDGI
LQYYKTNEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAAQTSMVTRLEQAFKELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgatttcgtaaaacctggcgttatcactggtgatgacgtacagaaa
gtgttccaggtagctaaagaaaacaacttcgctctgccagcagttaactgcgtaggtacc
gactccatcaacgccgtactggaaaccgctgcaaaagttaaagcaccggttatcgttcag
ttctctaacggcggcgctgcgttcatcgcaggtaaaggcgtgaaaactgacattcctcag
ggcgctgctatcctgggtgctatctctggtgcgcaccacgttcatcagatggctgaacac
tacggtgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gacggtctgctggacgcaggtgaaaaacactttgcagcaaccggtaagccactgttctct
tctcacatgatcgacctgtccgaagagtctctggaagaaaacatcgagatctgctctaag
tacctggcgcgtatgtccaaaatgggcatgaccctggaaatcgaactgggttgcaccggt
ggtgaagaagacggtgtggacaacagccacatggacgcttctgctctgtacactcagcca
gaagacgttgattacgcttacaccgagctgagcaaaatcagcccacgtttcaccatcgca
gcgtccttcggtaacgtgcacggcgtgtacaagccaggtaacgtggttctgaccccgacc
atcctgcgtgattctcaggaatacgtgtctaagaaacacaacctgccgcacaacagcctg
aacttcgtcttccacggcggttccggttcttctgctcaggaaatcaaagattccgtaagc
tacggcgtagtgaaaatgaacatcgataccgacacccaatgggcaacctgggacggtatc
ctgcaatactacaaaaccaacgaagcttacctgcaaggtcagctgggcaacccgaaaggc
gaagaccagccgaacaagaaatactacgatccacgcgtatggctgcgcgctgcacagacg
tccatggtgactcgtctggagcaggcattcaaagaactgaacgcgatcgacgttctgtaa

DBGET integrated database retrieval system