KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_21050Help
Entry
LI64_21050        CDS       T03709                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00051  Fructose and mannose metabolism
eclz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LI64_21050
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LI64_21050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Plant_all_beta
Motif
Other DBs
NCBI-ProteinID: AJB72887
Position
4427613..4428761
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARHSYQVHVVGENEQVETV
SGVNAVSSIGDDVIDLIANVDLVTTAVGPVVLERIAPAVAKGLAKRKAQGVDAPLNIIAC
ENMVRGTTQLKGHVLAAVADEDKAWVEAHVGFVDSAVDRIVPPSESATNDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DENIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHYRSEQDPQAIELAQLIDDKGAQAALAQ
ISGLDANSDVVAEAVSAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggcattaccctgacattcgccgatgtgaatcaggtggttctggatgccctg
aatgcccgtcatagctatcaggttcacgtggtgggtgaaaacgagcaggttgaaacggtc
tctggcgtcaatgcggtgagcagcattggcgacgacgtgatcgacctcatcgcgaacgtt
gacctcgtcaccactgccgtgggtccggtagtacttgagcgtatcgccccggcggttgcg
aaaggcctggcgaaacgtaaagcgcagggcgttgacgctccgctgaacatcatcgcctgt
gaaaacatggtgcgcggcaccacgcagttgaaaggccacgttcttgcggccgttgcagac
gaagataaagcctgggttgaagcgcacgtcgggtttgtagattccgccgttgaccgcatc
gttccgccatccgaatccgccaccaacgatccgctggaagtgaccgtggaaaccttcagc
gagtggatcgttgataaaacccagtttaagggcgcgctgccgaccattccgggaatggaa
ttaaccgataacctgatggcatttgtcgaacgtaaactcttcacgctgaacaccgggcat
gctataaccgcgtacctcggaaaattggccggtcatcagacgattcgtgacgcgatcctc
gatgagaacatccgtgcggtggtcaaaggggcaatggaagagagcggcgcggtgctgatc
aaacgctacggttttgatgctgataaacacgcagcatacatccagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgacgttgagcgcgtgggtcgtcagccgctgcgtaaa
ctaagcgcgggcgaccgcctgattaaaccgctgctgggcacgctggaatacggcctgccg
cacgctaacctggtgaagggcatcgctgccgctatgcactaccgcagcgagcaggacccg
caggcgattgagctggctcagctgattgatgacaaaggcgcgcaggctgcgctggcgcag
atctccggtctggatgccaacagtgacgtagttgcggaggcggtcagcgcatacaacgca
accaaatga

DBGET integrated database retrieval system