KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_21265Help
Entry
LI64_21265        CDS       T03709                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00561  Glycerolipid metabolism
eclz00640  Propanoate metabolism
eclz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI64_21265 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LI64_21265 (gldA)
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     LI64_21265 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AJB72923
Position
4481207..4482310
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVLTRLGDYLKPLANRWLVVGDKFVLGFAEETLRQSFKNAGLHAE
IAPFGGECSQNEIDRLKKLADSADCLAVLGIGGGKTLDTAKALAHFMDVPVAIAPTIAST
DAPCSALSVIYTDSGEFDRYLMLPHNPNMVIVDTKVVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLVEEGEKAMLAAEQHVVTPALERIIEANTYL
SGVGFESGGLAAAHAIHNGMTAVPDAHHFYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLNIKEDIPAKMRLIAEASCAEGETIHNMPGGVTPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtatcattcaatcgccggggaaatacatccagggcgcagatgttctcacccgt
ctcggcgactacctgaagccgctggcgaatcgctggctggtggtgggcgataaatttgtt
ctgggttttgctgaagaaaccctgcggcagagttttaaaaatgccggactccatgccgaa
atcgcaccgtttggcggcgaatgttcgcaaaatgaaatcgatcgtctgaaaaagctggca
gacagcgccgactgcctggcggtgctggggatcggcggcggtaaaacgctggataccgcc
aaagcgctggcccactttatggacgtgccggtggccattgccccgaccattgcctccacc
gatgcgccgtgcagcgccctctccgtaatttataccgacagcggcgagtttgatcgctac
ctgatgctgccgcacaacccgaacatggtaatagtcgacaccaaagtggtggcaggcgca
cctgcgcgcctgctggccgccgggataggcgatgccctcgcaacctggtttgaagcgcgc
gcctgctcacgcagcggtgctaccaccatggcaggcggcaagtgcacgcaggcggcgtta
gcgctggctgaactgtgctacaacacgctggttgaagaaggtgagaaggcgatgctcgcg
gcggaacagcacgtggtcacgcctgctctggaacgcattatcgaagccaacacttatctg
agcggtgtgggctttgaaagcggcgggctggcggcggctcacgccattcacaacggcatg
acggcggtaccggatgcgcaccatttctatcatggtgaaaaggtcgcgttcggcacgctg
acgcagctggtactggagaacgcaccggttgaagaaattgagaccgtcgccgcgctctgc
cacagcgttgggctgccgatcaccctggcacagctgaacatcaaagaggatatcccggcc
aaaatgcggctgatcgcggaagcgtcctgtgccgaaggggaaaccattcacaacatgcct
ggcggcgtaacgccggatcaggtgtatgcggcgctgctggtggcggaccagtacggacag
cggttcttgcaggagtgggagtaa

DBGET integrated database retrieval system