KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1516Help
Entry
EcSMS35_1516      CDS       T00672                                 

Gene name
sufS
Definition
(GenBank) cysteine desulfurase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00450  Selenocompound metabolism
ecm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EcSMS35_1516 (sufS)
Enzymes [BR:ecm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     EcSMS35_1516 (sufS)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     EcSMS35_1516 (sufS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACB16542
UniProt: B1LE56
Structure
PDB: 

Position
1502341..1503561
Genome map
AA seq 406 aa AA seqDB search
MTFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHT
LSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQ
MEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLEMLPNLFDEKTRLLAITHVSNVLGTE
NPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKE
ALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLN
NIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactttttccgtcgacaaagtgcgggccgactttccggtgctttctcgtgaggtgaac
ggtttgccgctggcttatctcgacagcgccgccagtgcacagaaaccgagccaggtgatt
gacgccgaggccgagttttatcgtcatggctacgcggcggtgcatcgcggtattcatacc
ttaagcgcccaggcgaccgagaaaatggagaacgtgcgcaagcgggcatcgctgtttatt
aatgcccgttcggcggaagagctggtgttcgtccgcggcacgacggaagggatcaatctg
gtcgccaatagctggggtaacagcaatgtgcgggcgggcgataacatcatcatcagtcag
atggagcaccacgctaacattgtcccctggcagatgctttgcgcacgcgttggcgcagag
ctgcgtgtgatcccgctcaaccccgacggtacgctgcaactggagatgctacctaatctg
ttcgatgagaaaactcgcctgctggcaattactcatgtctccaacgtgctgggaacggaa
aatccgctggcggaaatgatcacgcttgcgcaccagcatggcgcaaaagtgctggtggat
ggcgctcaggcggtgatgcatcatccggtggatgttcaggcgctggattgcgatttttac
gtgttttccgggcataaactgtatggccccaccgggattggcattctttatgtcaaagaa
gccttgttgcaggagatgccgccgtgggaagggggcggttctatgatcgccaccgtcagc
ctgagtgaaggcactacctggaccaaagcaccatggcggtttgaagccggtacacccaat
accgggggcatcattggtcttggcgcggcgctggagtatgtgtcggcgctggggcttaat
aacatagccgagtatgaacagaatctgatgcactacgcgctatcacagctggaatctgta
ccggatctcactctctatggcccgcagaacaggcttggcgttattgcttttaatctcggt
aaacaccacgcctatgatgttggcagttttctcgataactacggcattgctgtgcgtacc
ggacatcactgcgcaatgccattgatggcctattacaacgttcctgctatgtgtcgggcg
tcgctggccatgtataacacccatgaagaagtggatcgtctggtgaccggcctgcaacgt
attcaccgtttgctgggataa

DBGET integrated database retrieval system