KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1934Help
Entry
EcSMS35_1934      CDS       T00672                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00900  Terpenoid backbone biosynthesis
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01130  Biosynthesis of antibiotics
Module
ecm_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EcSMS35_1934 (ispE)
Enzymes [BR:ecm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EcSMS35_1934 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACB16950
UniProt: B1LH92
Structure
PDB: 

Position
1954218..1955069
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTINIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcaacattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgcggttattgatgaaaactgcggcagac
agcgggcgtcttccgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggtcctggtggcattaaatcat
ctctggcaatgcgggctaagcatggatgagctggcggaaatgggactgacgctgggcgca
gatgttcctgtctttgttcgggggcatgccgcgtttgccgaaggcgttggtgaaatacta
acgccggtggatccgccagagaagtggtatctggtggcgcaccctggtgtaagtattccg
acaccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system