KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_2133
Entry
EcSMS35_2133      CDS       T00672                                 

Definition
(GenBank) transcriptional regulator, GnsA/GnsB family
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
SSDB
Motif
Pfam: GnsAB_toxin PA28_alpha
Other DBs
NCBI-ProteinID: ACB18040
UniProt: B1LJ13
Structure
PDB: 
4XO1 4XO2

Position
complement(2144389..2144562)
AA seq 57 aa
MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKIKIM
NT seq 174 nt   +upstreamnt  +downstreamnt
gtgaatattgaagagttaaaaaaacaagccgaaacggaaatcgccgactttatcgcgcaa
aaaatcgccgagctgaacaagaatacagggaaagaagtctctgaaattcgcttcaccgca
cgggaaaaaatgaccgggcttgaaagttatgatgtcaaaatcaaaataatgtga

DBGET integrated database retrieval system