KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_2908Help
Entry
EcSMS35_2908      CDS       T00672                                 

Gene name
scrB
Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00052  Galactose metabolism
ecm00500  Starch and sucrose metabolism
ecm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EcSMS35_2908 (scrB)
   00500 Starch and sucrose metabolism
    EcSMS35_2908 (scrB)
Enzymes [BR:ecm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EcSMS35_2908 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ACB16593
UniProt: B1LQA3
Position
2981479..2982882
Genome map
AA seq 467 aa AA seqDB search
MPSQMPAILQAVMKGQSKAQADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNPLD
CNHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVKFD
DGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSRWYMVLGAQDKEKR
GKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDLFALDGEYILLCCPQGMAREH
ERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGVPD
GEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPPVAI
ERLEMDIIPSGELHLNFGNALALHLNDDGIQLQRKSLAGQEKLTRYWRGSVTSLKILCDS
SSIEIFINNGEGVMSNRYFPHHPASLILQGESDVTLHYWSLRACMVE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaagcacag
gcagatgcccactatccttgttggcatctcgctcccgtcaccggactaatgaacgatcca
aatggcttttgctggtcaggaggccgctatcatctgttttatcagtggaatccattggat
tgtaatcataagtacaaatgttgggggcactggagttcgacggatttattgcactggcag
catgaaccattagcgctaatgcccgataaagagtatgaccgtaatggttgttactcagga
agcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaagtttgat
gatggcagcagaacggcatggcaatgtctggccaccgaaaataaccagggcgggtttgat
aaattaggccctgtcataccgttacctgatggttacaccggacatgttcgtgatccaaaa
gtctggaagcacaacagccgatggtacatggtgcttggcgcgcaagataaagagaaacgg
gggaaagtgctgctgtattcctctgtcgatctctatacctggtcttttcatggagaaatt
gctggtaatggtctgaatgaaattgataacgcaggatacatgtgggaatgtcctgatctt
ttcgcccttgatggtgaatacattctcctctgctgcccccagggaatggcgcgcgaacat
gagcgctatctgaatacctatccctgcgcctggctacatggacagtttgattacgagaca
ggcaaatttacgcatggcgctttctcagagctggatgcgggatttgaattctatgcacca
cagacgatggaagccccggacgggcgacgattactggtcggctggatgggggttcctgat
ggcgaagagatgttgcaaccaaccagaaagcatcattggcagcatcaaatgacctgtttt
cgcgaactctcattccagaagggaaaattatttcagatgccaatcagggaactcgcgcaa
ctgcgtgaagctgaacacttctggcaaggaaaagcggatcatgcgccgcctgtcgcaatt
gaacgtctggaaatggacatcattccatcaggcgagctacatctgaattttggcaacgca
ctggcactgcatcttaatgacgatggtattcaactacagaggaaaagccttgcagggcaa
gagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgtgacagt
tccagcatagagatattcatcaataatggcgaaggcgtaatgagcaatcgttattttccc
catcatccagcttcgctgatattacagggcgagtctgacgtcacgttacactactggtcg
ctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system