KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_3001
Entry
EcSMS35_3001      CDS       T00672                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00230  Purine metabolism
ecm01100  Metabolic pathways
ecm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EcSMS35_3001 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACB17014
UniProt: B1LR50
Position
3082469..3082948
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaatcaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgtacagcaggcttatgctaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacagcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system