KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_3933Help
Entry
EcSMS35_3933      CDS       T00672                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00051  Fructose and mannose metabolism
ecm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EcSMS35_3933 (mtlD)
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     EcSMS35_3933 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: ACB17167
UniProt: B1LK35
Position
4009933..4011081
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHKNLIEGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggttcatgtggttggtgaaaccgagcaggtagataccgtt
tccggcgtcaatgctgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtt
gatttagtcactaccgccgtgggcccggttgtgctggaacgtattgccccggcaatcgcc
aaagggctggtgaaacgtaaagaacaaggtaatgaatccccgctgaacatcatcgcttgt
gaaaacatggtccgcggcaccacacagctgaaaggacatgtgatgaacgccctgccggaa
gatgccaaagcgtgggtagaagaacacgttggctttgttgattccgccgttgaccgcatc
gtgccgccttcggcttctgcaaccaacgatccgctggaagtgacggtagaaacattcagc
gaatggattgttgataaaacccagttcaaaggcgcgctgccgaacatcccaggcatggag
ttaaccgacaacctgatggcatttgtcgaacgtaaactcttcaccctgaatacgggtcat
gctataaccgcgtacctcggaaaactggcgggtcatcagaccattcgtgatgcgattctc
gacgagaaaatccgcgcggtggtaaaaggtgcgatggaagaaagcggtgcggtactgatc
aagcgctacggctttgacgcagacaagcatgcggcatacatccagaaaatcctcggtcgt
ttcgaaaacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccgctgcgtaaa
ctgagcgctggtgaccgtctgattaagccactgctcggtacactggaatatggtctgcca
cataaaaacctgattgaaggtattgccgctgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacag
atttccggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system