KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_4480Help
Entry
EcSMS35_4480      CDS       T00672                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IIA component
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00051  Fructose and mannose metabolism
ecm01100  Metabolic pathways
ecm02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EcSMS35_4480
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EcSMS35_4480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecm02000]
    EcSMS35_4480
Enzymes [BR:ecm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     EcSMS35_4480
Transporters [BR:ecm02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    EcSMS35_4480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete
Motif
Other DBs
NCBI-ProteinID: ACB16978
UniProt: B1LPI3
Position
complement(4577445..4577852)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGDARVEAVEFVPGENAGDIVAKLEKLVSIHNHDEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNIDELCEHLTQIAKQ
ICVVWRQVATAEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgccattttttgcgcccacggcaaattagcctgcgccatgctggaatcggtt
cagatggtgtacggcgatgccagggtcgaggccgttgaatttgtgcccggcgagaacgcc
ggagacattgtggcaaagctggagaagttagtgagcattcacaatcatgacgagtggcta
atcgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggcctttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatattgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
atctgcgtcgtctggagacaggtggcaacagcggaggaggatttctga

DBGET integrated database retrieval system