KEGG   Ehrlichia canis: Ecaj_0148Help
Entry
Ecaj_0148         CDS       T00270                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ecn  Ehrlichia canis
Pathway
ecn00020  Citrate cycle (TCA cycle)
ecn00640  Propanoate metabolism
ecn01100  Metabolic pathways
ecn01110  Biosynthesis of secondary metabolites
ecn01120  Microbial metabolism in diverse environments
ecn01130  Biosynthesis of antibiotics
ecn01200  Carbon metabolism
Module
ecn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecaj_0148
   00640 Propanoate metabolism
    Ecaj_0148
   00660 C5-Branched dibasic acid metabolism
    Ecaj_0148
Enzymes [BR:ecn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ecaj_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAZ68199
UniProt: Q3YSV6
Position
complement(225777..226937)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKHILSRFGVSVPKGAIVHSLSEVDDAISKLHSKVIVVKAQIHAGGRGKAGGV
VVCRTSDEAKASIKNMLGSTLVTHQTSKDGQKVRKVYLEEGCDIKKEYYISAIVNRKQSQ
VSIIFSTEGGVDIEEVASTSPEKVIVCNIDPLFGFQSFHGRNLCFDSNLSLDQTRKISDI
AEKIYKVMLSTDANQVEINPLVETSSGNFIALDAKINFDDNALYRHPDIQELRDYDEEIK
EEIEASKYGLNYIKMDGNIGCMVNGAGLAMATMDIIKYYGAEPANFLDVGGGASQKTVTE
AFKIILSDKVDGILVNIFGGIMRCDIIANGIIAAIEEIRINVPLVVRLSGTNFELGKKLL
DDSSLNIITANDLSEAAYNIVNIVKK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaggcaaaacatatactgagtaggtttggtgttagtgttcca
aaaggagctatagtacattcgttaagcgaagttgatgatgctataagtaaattacactca
aaagtaattgtcgttaaagcacaaatccacgctggcggcagaggtaaagctggtggagtt
gtagtatgtcgtacatcagacgaagctaaggcatccataaaaaacatgttaggatcaact
ttagttactcatcaaacttcaaaggatggacaaaaagtaaggaaagtatacctagaagaa
ggatgtgatataaagaaggaatattacattagtgctattgtaaatcgaaaacaaagtcaa
gtaagtataatattttcaactgaaggtggtgttgatatagaagaagtagcttcaacttct
ccagaaaaagttattgtgtgtaacattgatccactattcggatttcaaagtttccatgga
cgtaacttatgttttgatagcaacttaagcttagatcaaacaagaaaaatttctgatata
gctgagaaaatatataaagttatgttaagcactgatgctaatcaagtagaaatcaatcct
ttagttgagacatcctcaggaaatttcattgctcttgatgcaaaaataaattttgatgac
aatgcattatatcgtcatcctgacattcaagaattacgtgattacgatgaagaaattaaa
gaagaaatagaagcttctaagtacggtttaaattacattaagatggatggcaacattggc
tgtatggttaatggtgcaggtcttgctatggcaactatggatattattaaatactatgga
gctgaaccagcaaactttttagatgttggtggaggagcaagccaaaagactgttactgaa
gcatttaaaatcattttatcagataaagttgatgggatactagttaatatatttggtggt
atcatgcgttgtgatatcattgctaatggtattattgctgcaatagaagagattagaatt
aatgttccattagttgtaaggctatctggaacaaactttgaattaggaaaaaagttacta
gatgattcaagcctaaatattattacagcaaacgacttaagcgaagcagcatacaacata
gttaatatagtaaaaaaatag

DBGET integrated database retrieval system