KEGG   Ehrlichia canis: Ecaj_0389Help
Entry
Ecaj_0389         CDS       T00270                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ecn  Ehrlichia canis
Pathway
ecn00790  Folate biosynthesis
ecn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ecaj_0389
Enzymes [BR:ecn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ecaj_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AAZ68432
UniProt: Q3YS73
Position
587287..587859
Genome map
AA seq 190 aa AA seqDB search
MENGKPSDSQAEEAINLLIRWIGDDPDRVGLTGTAKRVLNIYKKFFSGYQVDMLSMQDSV
LLGENYDGMIIVKNTEFTSYCEHHIVPIKGKIDIGYIPDKLIFGLGKVIKLINCFTKRLQ
LQERLTMEIANALDYYLSPKGVIVSIEAVHDCVACCEEIDKNNLDLQTTCVIGIFKDNID
LRKEFFTNIG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggcaaaccttctgatagtcaagcagaagaagctattaatttattgatcagg
tggataggtgatgatccagatagagtaggtcttactggtactgctaagcgtgtgttgaat
atttataaaaagtttttttcagggtatcaagtagatatgctttctatgcaagattcagtt
ttacttggtgaaaattatgacggtatgataattgttaaaaatactgagtttacatcttat
tgtgaacaccatattgtgcctataaaaggtaaaatagatattgggtatattcctgataag
ttaatatttggtttaggtaaagtgattaaattgattaattgttttacaaaaagattgcag
cttcaggaaagattaacgatggaaatcgctaacgcattggattattatttatctcccaaa
ggagttattgtatctattgaagcagtacatgattgtgttgcatgttgtgaagaaatagat
aaaaataacttggacttgcaaaccacttgtgtaattgggattttcaaagataatatagat
cttagaaaagaattttttactaatattggttga

DBGET integrated database retrieval system